PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_014778
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 459aa    MW: 52576.7 Da    PI: 6.0496
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_014778genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3068.8e-94784551373
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++lLl  A++v++++l    + L++l +++  +gd++qR+aayf+ +L arl+   s  y+ +  ++++    +ee+ a++ +++vsP+++f+h+ta
  DCAR_014778  78 LIHLLLISATFVDENKLDSSVESLSELFQNVCLTGDSVQRVAAYFADGLVARLLTRKSPFYNMIMKEPSA----EEEFLAFTELYKVSPYYQFAHFTA 171
                  689****************************************************999999988777775....788889999*************** PP

         GRAS  99 NqaIleavege.....ervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeel.gvpfefnvlvakrled 188
                  NqaI ea+e+e     +++H+iDfd+s+G+QWp+L+q+L++++  ++  slRiTg+g+    s eel+et+ rL  fA+ + +++fef+ l  +   +
  DCAR_014778 172 NQAIIEAFEKEedsnnRALHVIDFDVSYGFQWPSLIQSLSDKAtsSSRISLRITGCGR----SLEELQETETRLVCFAKGFrNITFEFQGL-LRG--S 262
                  *********9988887889*********************999645555*********....9****************9758*******7.443..4 PP

         GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                   ++ +++ +++E++aVnlv++l +l     + + +++++Lk+v  l+P +v++veqea++n  sFl++f+e+l+y++a+fdsl+  lp +s+ r  +E
  DCAR_014778 263 SDFADIKRRNNETVAVNLVFHLNTLT----NFS-KISDTLKTVHFLNPAIVILVEQEASRNPRSFLAQFMESLHYFAAMFDSLDDCLPLDSDGRLGIE 355
                  45699******************998....222.35579*********************************************************** PP

         GRAS 287 rellgreivnvvacegae.rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvks......dg....yrveee..sgslvlgWkdrpLvsvS 371
                  +  lgrei++    e+++   ++ e++++W+er+e  GF+ ++ls+k ++qaklll++ ++      dg    +rv e+  s +l lgW+dr L+++S
  DCAR_014778 356 KNHLGREIKSFMNYEKDSsNCNKYERMKTWKERMEGHGFRGLKLSSKSVMQAKLLLKMRSQycpvqcDGenggFRVFERdeSTALSLGWQDRFLLTAS 453
                  **************9998467899********************************986521111111122247777663344555************ PP

         GRAS 372 aW 373
                  aW
  DCAR_014778 454 AW 455
                  ** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.88452424IPR005202Transcription factor GRAS
PfamPF035143.0E-9178455IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MEETDEQEEF LTLTLAIVAD SRFDKKRKRR KREESIEPVS SNEDCEGRIF SLLQLREQML  60
KLDRKRKGVA EDGKGLHLIH LLLISATFVD ENKLDSSVES LSELFQNVCL TGDSVQRVAA  120
YFADGLVARL LTRKSPFYNM IMKEPSAEEE FLAFTELYKV SPYYQFAHFT ANQAIIEAFE  180
KEEDSNNRAL HVIDFDVSYG FQWPSLIQSL SDKATSSSRI SLRITGCGRS LEELQETETR  240
LVCFAKGFRN ITFEFQGLLR GSSDFADIKR RNNETVAVNL VFHLNTLTNF SKISDTLKTV  300
HFLNPAIVIL VEQEASRNPR SFLAQFMESL HYFAAMFDSL DDCLPLDSDG RLGIEKNHLG  360
REIKSFMNYE KDSSNCNKYE RMKTWKERME GHGFRGLKLS SKSVMQAKLL LKMRSQYCPV  420
QCDGENGGFR VFERDESTAL SLGWQDRFLL TASAWHCV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-548645527378Protein SCARECROW
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12429KKRKRR
22431KKRKRRKR
32530KRKRRK
42531KRKRRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017245610.10.0PREDICTED: scarecrow-like protein 23
TrEMBLA0A162AAA70.0A0A162AAA7_DAUCS; Uncharacterized protein
STRINGEMJ002090.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA123541823
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.14e-52GRAS family protein