PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_014177
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Dof
Protein Properties Length: 359aa    MW: 39123.2 Da    PI: 4.5986
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_014177genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.64.7e-371977462
       zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                  a++cprCds +tkfCyynnyslsqPryfCk+C+ryWtkGGalrnvP+Gg++rk kk s
  DCAR_014177 19 PATNCPRCDSPKTKFCYYNNYSLSQPRYFCKTCKRYWTKGGALRNVPIGGSCRKTKKIS 77
                 6789***************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088428.0812175IPR003851Zinc finger, Dof-type
PfamPF027019.5E-322175IPR003851Zinc finger, Dof-type
ProDomPD0074789.0E-252375IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102359IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MSNYQSSGSH DKSVVTPPPA TNCPRCDSPK TKFCYYNNYS LSQPRYFCKT CKRYWTKGGA  60
LRNVPIGGSC RKTKKISRSF SSDSKDSSSA SSYSDLGRFG FSDGPDFQIG EGLIDVPRSN  120
NTSNIPTIRG QLVSSTMNNP IVPISSGSIP NFGLNPDSQT NLSQFVAPND FSLCYSSSSS  180
ILKQYHVENN VVSFNDGLAP EMVPVIGNLS SSMDSFGSIS QDLYLNLPQE RMGEPFSSTD  240
LDWELQQEGM NMMLSGGSSN IYQQPSNMIE TTNNLENLAP LLKPYPASFQ DLEISSEPSN  300
ISRKEDNGVA NVETTNVPIE WHFGDSSYAP AVNAIPSIDG NGNKIEGWSV FDQYPSLP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017245695.10.0PREDICTED: dof zinc finger protein DOF5.7-like
TrEMBLA0A165XS620.0A0A165XS62_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52422234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21050.16e-31Dof-type zinc finger domain-containing protein