PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_014176
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 531aa    MW: 58351.2 Da    PI: 5.3184
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_014176genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS452.72.4e-1381615251374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl.fsevsPilkfshlt 97 
                  lv++Ll+cAea++ +dl+la+al++++s l++++  +m+++a+yf+ ALa+++++       ++p  +     +++ l ++++ f+e +P+lkf+h+t
  DCAR_014176 161 LVHTLLACAEAIQVDDLKLADALVKHVSLLSTSQVGSMRKVASYFAHALARKIYK-------IFPKDSL----EVSFLDMYQMhFYESCPYLKFAHFT 247
                  689***************************************************9.......3344444....45556666666************** PP

         GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLr 195
                  aNqaIlea++g++rvH+iDf+++qG+QWpaLlqaLa R++gpps+R+Tg+g+p+++++++l+e+g +La++Ae++g++fef+ +va++l+d++ ++L+
  DCAR_014176 248 ANQAILEAFAGCNRVHVIDFGLKQGMQWPALLQALALRNGGPPSFRLTGIGPPQPDNTDALQEVGYKLAQLAESIGIEFEFRGFVANSLADIDASMLN 345
                  ************************************************************************************************** PP

         GRAS 196 vkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl.eaklpres.eerikvErel 289
                  ++p  +Ea+aVn+v++lhrll++++++e+    vL+ +k+++Pk+v+vveqe++hns+ Fl+rf++al+yys++fdsl  +++ +++  ++  ++ ++
  DCAR_014176 346 IRPreEEAVAVNSVFELHRLLARPGAIEK----VLNSIKKMNPKIVTVVEQESNHNSPVFLDRFTQALHYYSTMFDSLeTTGFTQTNdTQDLLMSDVY 439
                  **9999***********************....*********************************************5555666666999******* PP

         GRAS 290 lgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  lgr+i+nvv+ceg +r+erhetl +Wr r+ eaGF +v+l+++a+kqa++ll+ ++ +dgy+vee++gsl+lgW++r+L+++SaW+
  DCAR_014176 440 LGRQICNVVSCEGPDRVERHETLTQWRTRMCEAGFDSVHLGSNAYKQASMLLALFAgGDGYQVEENDGSLMLGWHTRSLIATSAWQ 525
                  *************************************************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120418.8E-273095IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011291.6E-2530102No hitNo description
PROSITE profilePS5098566.279135504IPR005202Transcription factor GRAS
PfamPF035148.1E-136161525IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 531 aa     Download sequence    Send to blast
MVTKRDRPPE KGQGSSAAKM WIEDQPDTMD ELLAVLGYKV RASDMTVIAK KLEQLEVAMG  60
IDTVHGATHL SETTHYNPAD ISTWVESMLT ELSPSVSETH SSLIHDNHSE YDLRAIPGGA  120
IYGGDSSTSS GSKRMKVSES CVVESGPGPL VVDSQEAGVR LVHTLLACAE AIQVDDLKLA  180
DALVKHVSLL STSQVGSMRK VASYFAHALA RKIYKIFPKD SLEVSFLDMY QMHFYESCPY  240
LKFAHFTANQ AILEAFAGCN RVHVIDFGLK QGMQWPALLQ ALALRNGGPP SFRLTGIGPP  300
QPDNTDALQE VGYKLAQLAE SIGIEFEFRG FVANSLADID ASMLNIRPRE EEAVAVNSVF  360
ELHRLLARPG AIEKVLNSIK KMNPKIVTVV EQESNHNSPV FLDRFTQALH YYSTMFDSLE  420
TTGFTQTNDT QDLLMSDVYL GRQICNVVSC EGPDRVERHE TLTQWRTRMC EAGFDSVHLG  480
SNAYKQASML LALFAGGDGY QVEENDGSLM LGWHTRSLIA TSAWQLVGPV *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-7015652414378Protein SCARECROW
5b3h_A3e-7015652413377Protein SCARECROW
5b3h_D3e-7015652413377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway (By similarity). Its degradation is not essential for germination. {ECO:0000250, ECO:0000269|PubMed:15347801}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017246835.10.0PREDICTED: DELLA protein GAI
SwissprotQ7Y1B60.0GAI_SOLLC; DELLA protein GAI
TrEMBLA0A162AAM20.0A0A162AAM2_DAUCS; Uncharacterized protein
STRINGVIT_14s0006g00640.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein
Publications ? help Back to Top
  1. Nir I, et al.
    The Tomato DELLA Protein PROCERA Acts in Guard Cells to Promote Stomatal Closure.
    Plant Cell, 2017. 29(12): p. 3186-3197
    [PMID:29150547]