PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_013537
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family bZIP
Protein Properties Length: 744aa    MW: 80565.2 Da    PI: 6.7957
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_013537genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1422.1e-13241301363
                  XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  + kr  r+++NRe+A+ sRqRKk ++eeLe+kv ++ +  ++L  +++ +  e a+l+++ 
  DCAR_013537 241 DEKRKTRLMRNRESAQLSRQRKKHYVEELEDKVRAMHSTIQDLNAKISYIVAENATLRQQQ 301
                  569*********************************************9999999999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-15239303IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.496241300IPR004827Basic-leucine zipper domain
PfamPF001709.8E-12243301IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.73E-11243300No hitNo description
Gene3DG3DSA:1.20.5.1704.2E-15243301No hitNo description
CDDcd147041.23E-20244295No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 744 aa     Download sequence    Send to blast
MADQIAADPI SDYDGLVVPP LGDSFFSDDI NNSLLFLNES DDVLNFDFTF DDIVNLSNDT  60
SNFRDSSLPD SIPSPELTHL SDDPNFNVAG YFNADGDKSG DNSSASVPKC SDCLSVEVVR  120
VCDDASQVNV SSSDSRDSSN ECENKDVNGG GDSKVEALKM EFSGPTSSQG SDNCERSVGS  180
SMKLDKNLPG KNGQLLKRKK EDQDVNSDST RTIKYRRSAN AGAAAVTTDE SNVISETNDD  240
DEKRKTRLMR NRESAQLSRQ RKKHYVEELE DKVRAMHSTI QDLNAKISYI VAENATLRQQ  300
QMNGGGGVGV GPPPMQGMYP HPPMAPMGYP WMPCPPYMMK PQGSQVPLVP IPRLKPQQSA  360
VKPVKKEGSK KNVGKSKTKK VASVSFLGIL FFMLLFGGLV PMVSVKYGGI RDAISGGSGY  420
IRNIIYDQRH ERILMVNGTN HEYGAKGSDN KYDAWKDHVG GTESNIKQSG SDEFASSGNA  480
SDPLVASLYV PRNDKLVKID GNLIIHSVLA SEKAKASHDD VKAKSDRETS LALALHLTPP  540
VSVQGAGKDD ERQSHIYRST IEQQRALASG SGGKDNLKST PANGKLQQWF REGLAGPMLS  600
SGMCTEVFQF DVSPSPGAIV PATPGSRNIS EEERKNSTHL IKGRNRRILH GLSVPLTGSA  660
NNISKENNRS KTQKEKFHSN SSVSPMIVSV LVDPREVGDA DVDGTIGTKS ISRIFVVVLL  720
DSVKYVTYSC MLPFKGSSHL VTA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017247444.10.0PREDICTED: bZIP transcription factor 17-like
TrEMBLA0A165YIC30.0A0A165YIC3_DAUCS; Uncharacterized protein
STRINGVIT_08s0040g00870.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30292450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.11e-158bZIP family protein