PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_013521
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 249aa    MW: 27266.7 Da    PI: 7.9004
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_013521genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1062.1e-333791155
      G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                 k+rlrWt++LH+rFv+a++qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  DCAR_013521 37 KQRLRWTSDLHDRFVDAIAQLGGPDRATPKGVLRVMGVPGLTIYHVKSHLQKYRL 91
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.253494IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-323592IPR009057Homeodomain-like
SuperFamilySSF466892.51E-173691IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-263792IPR006447Myb domain, plants
PfamPF002492.8E-83990IPR001005SANT/Myb domain
PfamPF143791.4E-24124169IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MGLVPYKAQG SEQISPVAAV GGPPVETSPP PAGANAKQRL RWTSDLHDRF VDAIAQLGGP  60
DRATPKGVLR VMGVPGLTIY HVKSHLQKYR LAKYLPESPA DGSKEDKKIS GDSLDSMDSP  120
PGLQINEALR MQMEVQKRLH EQLEVQRQLQ MRIEAQGKYL QKIIEEQQKL GSSLVGTESQ  180
PGGEDKQFQS YSHQATDASV QPLSPRKKQK VINEGPDGSA PSLAAPEIGN HWDPKWYNND  240
SQFRGPMD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-223794158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-223794158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-223794158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-223794158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017243654.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
SwissprotQ9SJW05e-74PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLA0A165YIT30.0A0A165YIT3_DAUCS; Uncharacterized protein
STRINGXP_008240600.11e-107(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27962451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.12e-76G2-like family protein