PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_013212
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 549aa    MW: 60949.6 Da    PI: 4.8172
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_013212genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS425.64e-1301825482374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                  +e+L++cA+av+++dl  a++l+++l+ ++s +g+p+qRl ay++e+L arl++s+++++k+l+++e +   sse ++++++++e++P++kf+++ aN
  DCAR_013212 182 KEVLVNCAKAVADNDLLTAEWLISELRPMVSVSGNPLQRLGAYMLEGLVARLSSSGNSICKTLKCKEPT---SSELFSYMNVLYEICPYFKFGYMSAN 276
                  689*****************************************************************9...9************************* PP

         GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLr 195
                   aI ea++ e+ +HiiD++i++G+QW +L+qaLa+Rp+gpp++RiTg+++++ +  +   l  +g+rL+++A++++vpfefn+    +++  ++++++
  DCAR_013212 277 GAIAEAMKDENSIHIIDIQIGEGAQWFTLIQALAARPGGPPRIRITGIADASLDyvRGGGLDIVGQRLSSLADSCKVPFEFNA---ATISGSDIDSIK 371
                  **************************************************99889999************************9...58889999**** PP

         GRAS 196 vkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgre 293
                  + pgEa+aVn+++ lh+++desv + ++rd++L++ kslsPkvv+vveqea++n+  F+ rfle+++y++a+f+s++++lpr++++ri+vE+++++r+
  DCAR_013212 372 ILPGEAIAVNFAFILHHIPDESVGTVNHRDKILRFAKSLSPKVVTVVEQEANTNT-LFMPRFLESMNYHMAIFESIDVTLPRDHKQRISVEQHCFARD 468
                  *****************************************************75.7***************************************** PP

         GRAS 294 ivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  ivn vacegaer+er+e lekWr+r+ eaGFkp+pls+++++++k+ll++++ + y+++e++g+l+lgW +++Lv++SaWr
  DCAR_013212 469 IVNTVACEGAERVERQELLEKWRSRFIEAGFKPYPLSSYVNATIKSLLENYN-ECYTLKEKDGALYLGWLKQNLVAASAWR 548
                  ****************************************************.77*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.721155529IPR005202Transcription factor GRAS
PfamPF035141.4E-127182548IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 549 aa     Download sequence    Send to blast
MTNYYSMQSS QDQQYFYQSG RFYNEPAHEF ESQLWNHHQY LDDNLWLDDS SQEMQVSGKA  60
SQSYGTPETA TAIGGYTGTN FVVSRSANGS PVSGESSQTY PSVVNHSPGN NIYNSQVSDS  120
FYMGDFVNLK HKIKEIETAM LGPESDTEMS ADISLFGAQS EMSSEKDYVN QMIAIISNGD  180
IKEVLVNCAK AVADNDLLTA EWLISELRPM VSVSGNPLQR LGAYMLEGLV ARLSSSGNSI  240
CKTLKCKEPT SSELFSYMNV LYEICPYFKF GYMSANGAIA EAMKDENSIH IIDIQIGEGA  300
QWFTLIQALA ARPGGPPRIR ITGIADASLD YVRGGGLDIV GQRLSSLADS CKVPFEFNAA  360
TISGSDIDSI KILPGEAIAV NFAFILHHIP DESVGTVNHR DKILRFAKSL SPKVVTVVEQ  420
EANTNTLFMP RFLESMNYHM AIFESIDVTL PRDHKQRISV EQHCFARDIV NTVACEGAER  480
VERQELLEKW RSRFIEAGFK PYPLSSYVNA TIKSLLENYN ECYTLKEKDG ALYLGWLKQN  540
LVAASAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-601785481375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017247093.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A165YZC80.0A0A165YZC8_DAUCS; Uncharacterized protein
STRINGVIT_19s0090g01740.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Heyman J, et al.
    The heterodimeric transcription factor complex ERF115-PAT1 grants regeneration competence.
    Nat Plants, 2016. 2(11): p. 16165
    [PMID:27797356]