PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_013052
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 219aa    MW: 24244.3 Da    PI: 8.7484
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_013052genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260103.12.5e-3214112199
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCa+C+++r+kC+++C+lap fp +++++f++vhk+FG+snv+k+lk+l+ ++r++a++slv+eA  r++dP+ G +g ++++ ++l+  k+e ++ k
  DCAR_013052  14 ACASCRHQRKKCTEKCTLAPFFPVDKNREFQAVHKVFGVSNVTKILKRLNLDDRKRAADSLVWEAFSRQKDPILGPFGEYRRVIEELNWYKNEYQAYK 111
                  7*********************************************************************************9999999999988776 PP

       DUF260  99 e 99 
                  +
  DCAR_013052 112 S 112
                  5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575115No hitNo description
PROSITE profilePS5089123.21613114IPR004883Lateral organ boundaries, LOB
PfamPF031957.0E-3114109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MQRSNGGGAN AAGACASCRH QRKKCTEKCT LAPFFPVDKN REFQAVHKVF GVSNVTKILK  60
RLNLDDRKRA ADSLVWEAFS RQKDPILGPF GEYRRVIEEL NWYKNEYQAY KSSLTAPGGL  120
INGLNETVMS NAGGMINYDA NKYNIMNSKG TVVSGLYPSF NYYSCVPNNK LSEESDNSCV  180
IMPHQPVING SSINQHSYQL PGQYGAIDAK ELEWNGNS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-20111148111LOB family transfactor Ramosa2.1
5ly0_B2e-20111148111LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017246575.11e-164PREDICTED: LOB domain-containing protein 2
RefseqXP_017246576.11e-164PREDICTED: LOB domain-containing protein 2
TrEMBLA0A165Z4441e-163A0A165Z444_DAUCS; Uncharacterized protein
STRINGXP_009770460.13e-52(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA101771827
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.14e-36LOB domain-containing protein 2