PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_013033
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 434aa    MW: 47824.6 Da    PI: 6.6799
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_013033genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.71.1e-27155209156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k +++WtpeLH+rFv+aveqL G +kA+P++ilelm++++Lt+++++SHLQkYR++
  DCAR_013033 155 KVKVDWTPELHRRFVQAVEQL-GVDKAVPSRILELMEIHCLTRHNIASHLQKYRSH 209
                  5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.534152211IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-26153212IPR009057Homeodomain-like
SuperFamilySSF466895.73E-18153212IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-26155209IPR006447Myb domain, plants
PfamPF002493.1E-7158207IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MLAVAPLRNP RDEAAGEPRF SIIDDEFPDL SGDHLLDSID FDDLFIGMED EDVLPSLEIE  60
SDDIFAEFNS VSGGDESETN ATSLYVENFD NISSRSYNQE EDKVSGSDFG SGSGRLNQGE  120
QIRNKSDEIN VSAKVPTKEE AKRKKSSKNH QGKRKVKVDW TPELHRRFVQ AVEQLGVDKA  180
VPSRILELME IHCLTRHNIA SHLQKYRSHR KHLLAREAEA ASWTQRRQAY GAASEGGGCK  240
REMNSTSPWL APTLGFPPNN IPHHFRPLHV WGHPSMEQPL MHVWPPKHLA PSPSPPSPMW  300
PPVTASPHLP QPPPNPSFWN SRYQRNGHSK IPRNHCFAPS MASPRFAAAA APVPGIPPHA  360
MYKVDPVSAP PRPPFDFHPS KESIDAAIGD VLSKPWLPLP LGLKPPSTDS VVGELHRQGV  420
DNIPPGGACA STT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-15152207257ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017243616.10.0PREDICTED: probable transcription factor GLK1
TrEMBLA0A165Z4N70.0A0A165Z4N7_DAUCS; Uncharacterized protein
STRINGGLYMA12G33430.11e-134(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25322356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.16e-62GBF's pro-rich region-interacting factor 1