PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_012989
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family TCP
Protein Properties Length: 182aa    MW: 19441.5 Da    PI: 8.5028
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_012989genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP112.84.7e-3533108681
          TCP   6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssss 81 
                     +++h+kv+gR+RRvR++a+caar+F+L++eLG+++d++tieWLl+ a+pai+ +tgt++ +++ c++++  +s
  DCAR_012989  33 PVVKDRHSKVNGRGRRVRMPALCAARVFQLTRELGHKSDGETIEWLLRHAEPAIIRATGTGTMPSQVCTSGDPINS 108
                  5669*************************************************************99966555555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136927.6293589IPR017887Transcription factor TCP subgroup
PfamPF036342.4E-3036108IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MASSNRVLSI KPAKSLKDLV PYKPGENIGV VKPVVKDRHS KVNGRGRRVR MPALCAARVF  60
QLTRELGHKS DGETIEWLLR HAEPAIIRAT GTGTMPSQVC TSGDPINSAG ISEMAPVAVS  120
GPVGFGAGMM IGGVGTDCRL DLWHGIGGDV VEYRNMGFTS LLMEPMMGEA EQQQVEQLSW  180
V*
Functional Description ? help Back to Top
Source Description
UniProtCan specifically bind site II elements in the promoter region of PP438/PNM1. {ECO:0000269|PubMed:21297037}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017247125.11e-131PREDICTED: transcription factor TCP8-like
SwissprotQ9C5182e-34TCP8_ARATH; Transcription factor TCP8
TrEMBLA0A165Z5X91e-130A0A165Z5X9_DAUCS; Uncharacterized protein
STRINGSolyc09g008030.1.14e-44(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24824201
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.12e-36TCP family protein
Publications ? help Back to Top
  1. Mazur MJ, et al.
    Arabidopsis TCP Transcription Factors Interact with the SUMO Conjugating Machinery in Nuclear Foci.
    Front Plant Sci, 2017. 8: p. 2043
    [PMID:29250092]