PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_012761
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 209aa    MW: 22878.8 Da    PI: 9.6286
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_012761genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.2e-32113166255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  pr+rWt+ LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  DCAR_012761 113 PRMRWTSSLHSHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 166
                  9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.85E-16111167IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.9E-29111167IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-24113166IPR006447Myb domain, plants
PfamPF002492.2E-7114165IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MASAASNMPD LSLQIRPPCT KPMRGYNNGG LMKKYMGERS DSASSGGSSD LSHEYGCHPR  60
SYLSLGLEMV SGLSPPPPAK YQHYQPHIYG RDFKRSSTSR TMNGASKRSA RAPRMRWTSS  120
LHSHFVHAVQ LLGGHERATP KSVLELMNVK DLTLAHVKSH LQMYRTVKNT DKGLIGQGQT  180
ETEDFKQGTE GTGGDGDACD YLLMPSYQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-17114168458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-17114168458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-17114168458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-17114168458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-17114168458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-17114168458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-17114168458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-17114168458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates carpel integuments formation. Required for the specification of polarity in the ovule inner integument. Modulates the content of flavonols and proanthocyanidin in seeds. {ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:19054366, ECO:0000269|PubMed:20444210}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017246192.11e-152PREDICTED: probable transcription factor KAN4 isoform X1
RefseqXP_017246193.11e-152PREDICTED: probable transcription factor KAN4 isoform X2
SwissprotQ9FJV53e-51KAN4_ARATH; Probable transcription factor KAN4
TrEMBLA0A165ZCP01e-153A0A165ZCP0_DAUCS; Uncharacterized protein
STRINGcassava4.1_011255m2e-57(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA122621822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.29e-54G2-like family protein
Publications ? help Back to Top
  1. Lora J,Hormaza JI,Herrero M
    Transition from two to one integument in Prunus species: expression pattern of INNER NO OUTER (INO), ABERRANT TESTA SHAPE (ATS) and ETTIN (ETT).
    New Phytol., 2015. 208(2): p. 584-95
    [PMID:25991552]
  2. Skinner DJ,Brown RH,Kuzoff RK,Gasser CS
    Conservation of the role of INNER NO OUTER in development of unitegmic ovules of the Solanaceae despite a divergence in protein function.
    BMC Plant Biol., 2016. 16(1): p. 143
    [PMID:27350128]
  3. Gomez MD,Ventimilla D,Sacristan R,Perez-Amador MA
    Gibberellins Regulate Ovule Integument Development by Interfering with the Transcription Factor ATS.
    Plant Physiol., 2016. 172(4): p. 2403-2415
    [PMID:27794102]