PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_012720
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family bZIP
Protein Properties Length: 371aa    MW: 41728.8 Da    PI: 6.6106
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_012720genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.42.3e-11206264563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  kr+rr + NR +A rs +RK  +i eLe+kvk+L++e kaL+ +l+ +k+ +  l +e+
  DCAR_012720 206 KRARRIMANRQSAARSKERKARYISELERKVKSLQTEAKALATQLNIYKEDAVHLAAEN 264
                  9*************************************************998888777 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.6E-13202266IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.553204267IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.88E-10206259No hitNo description
Gene3DG3DSA:1.20.5.1708.6E-9206261No hitNo description
PfamPF001701.4E-9206264IPR004827Basic-leucine zipper domain
CDDcd147031.54E-20207256No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MNMDDKMSTH LRSPLKAFHH QRGFSDVTTF QFPCSIIHRP TIKLGGGDSC PDIVQLDQEI  60
NTTHINNNEF MSSSIKDNDL DYDAFFSKFI DVDNNDQEEK CSVINNLCGD DASQVKQIDV  120
NFNYNQRDGI NWVNTPDGDG DGDEDKEEEQ QLDRRKRFES PDGPAPSPQH YPNLSVAAGS  180
NIQTSVEAKR AVSAAKLAEL WIVDPKRARR IMANRQSAAR SKERKARYIS ELERKVKSLQ  240
TEAKALATQL NIYKEDAVHL AAENKELKLR LQTMEHQAHL QDDITEAMMG EVERLRFTTG  300
EIVPSSSLKL GLVTLPDWFL KTKSFPLKIK GSDGARGRTI RENLFSDNIS MSRGSKSRFT  360
ATAVPTILRI *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017240198.11e-157PREDICTED: uncharacterized protein LOC108212994
TrEMBLA0A166CJ740.0A0A166CJ74_DAUCS; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-52bZIP family protein