PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_012705
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family bZIP
Protein Properties Length: 153aa    MW: 17468.9 Da    PI: 7.9622
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_012705genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.81.2e-133586657
                 HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1  6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57
                 + +r+q+NReAArrsR +K++ + eL +++ +L+++ k   +++++ +++  
  DCAR_012705 35 KRKRMQSNREAARRSRMKKQQHVHELITEIGQLQNQCKVIMSKINQVTNMFL 86
                 679********************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.7E-122783No hitNo description
SMARTSM003381.6E-133094IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.7033283IPR004827Basic-leucine zipper domain
PfamPF001702.5E-103584IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.5E-113586No hitNo description
CDDcd147021.61E-143585No hitNo description
PROSITE patternPS0003603752IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MMTPQRQNGS GSDKFDACNR MRLLISDDDD FDENKRKRMQ SNREAARRSR MKKQQHVHEL  60
ITEIGQLQNQ CKVIMSKINQ VTNMFLGVVS ENNASRAQLS DMTKRFHLLK SVVQFVEEAE  120
DLGIDVSDVL MESPKFPCPK QQVPTSANMF DC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017240195.11e-109PREDICTED: bZIP transcription factor 53-like
TrEMBLA0A166CIS21e-109A0A166CIS2_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28102351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.13e-30basic region/leucine zipper motif 53