PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_012554
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family NAC
Protein Properties Length: 293aa    MW: 33475.8 Da    PI: 5.9104
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_012554genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.81.3e-50101381129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrF P+deelv++yL+kkv++++++   ++ ++d++++ePw+Lp ++k ++++wyfFs rd+kyatg r+nrat+sgyWkatgkd++v++  ++
  DCAR_012554  10 LPPGFRFYPSDEELVCHYLHKKVAHEDVSK-GTLVDIDLHTCEPWQLPDAAKLNSTDWYFFSFRDRKYATGFRTNRATTSGYWKATGKDRTVVDPrTN 106
                  79*************************988.88***************88888999**************************************8556 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                    vg++ktLvfyk+rap+g+kt W+mhe+rle
  DCAR_012554 107 CIVGMRKTLVFYKNRAPNGVKTGWIMHEFRLE 138
                  67***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.67E-618156IPR003441NAC domain
PROSITE profilePS5100557.11810156IPR003441NAC domain
PfamPF023656.5E-2811137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MGLRDIGAAL PPGFRFYPSD EELVCHYLHK KVAHEDVSKG TLVDIDLHTC EPWQLPDAAK  60
LNSTDWYFFS FRDRKYATGF RTNRATTSGY WKATGKDRTV VDPRTNCIVG MRKTLVFYKN  120
RAPNGVKTGW IMHEFRLENP LIPPKEDWVL CRVFYKSKTE SSTELSPQNV CHSEATAGGD  180
IFPNAAQIML PAPFNKNNYH LHQIPSSQNP APHHQNPNTL QTFSQLNPNF LQLSHQFHTD  240
DLSEMIMIKS KCDDEDPYGF LLDMEFEEST MGDGMASSME DMKFEDDYCL FL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-47915916168NO APICAL MERISTEM PROTEIN
1ut4_B4e-47915916168NO APICAL MERISTEM PROTEIN
1ut7_A4e-47915916168NO APICAL MERISTEM PROTEIN
1ut7_B4e-47915916168NO APICAL MERISTEM PROTEIN
3swm_A4e-47915919171NAC domain-containing protein 19
3swm_B4e-47915919171NAC domain-containing protein 19
3swm_C4e-47915919171NAC domain-containing protein 19
3swm_D4e-47915919171NAC domain-containing protein 19
3swp_A4e-47915919171NAC domain-containing protein 19
3swp_B4e-47915919171NAC domain-containing protein 19
3swp_C4e-47915919171NAC domain-containing protein 19
3swp_D4e-47915919171NAC domain-containing protein 19
4dul_A4e-47915916168NAC domain-containing protein 19
4dul_B4e-47915916168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017240351.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
TrEMBLA0A169WE210.0A0A169WE21_DAUCS; Uncharacterized protein
STRINGEOX944241e-119(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.12e-88NAC domain containing protein 74