PlantRegMap
Plant Transcription Factor Database
PlantTFDB
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_012343
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 561aa    MW: 63725.8 Da    PI: 5.4396
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_012343genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS274.63.1e-841765481374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetsekn..sseelaalklfsevsPilkfsh 95 
                  l +lLl++A+ + +g+   a++lL r +  as++g+p++Rla+yf eAL++r++r ++s+  k ++ ++ +++n  s+ + + + + ++  P+ k+ +
  DCAR_012343 176 LAHLLLAAADKIWDGKIDSARRLLMRCECKASKSGNPVERLASYFSEALQERIFReTGSRRIKMVSYEARTPNNglSTGVDKTVLATHDDIPFSKVMQ 273
                  579****************************************************888899999999888888865333444444478889******* PP

         GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlele 192
                  +++ q+Il+ v+ e+ +HiiD+ i  G++Wp+++qaL++R+ ++  +l+iT+++    ++k+++e + +rL++fA+ l++ f+fnv++++++ dl+ e
  DCAR_012343 274 FATTQTILDHVAMETNIHIIDLHIRSGIHWPPMIQALSERKaHPIQHLKITALDT---EDKQKVEDICKRLESFANPLNIAFSFNVVTVDDIRDLKKE 368
                  ****************************************955556********9...58************************************** PP

         GRAS 193 eLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErell 290
                   + ++ gEa+++     l ++     + +++ +++++++ +++P +++v e +a+ ns+sF +rf+eal +ys+ fd+le  l r ++ r+++E+ ++
  DCAR_012343 369 LFGIQAGEAVVIYAPTILRTMI----PWPDKLETLMRVIGDIRPLLMIVQEVDANDNSPSFINRFVEALFFYSTWFDCLEDCLDRSNQYRMTLENNYF 462
                  ****************999998....55555566**************************************************************** PP

         GRAS 291 greivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrk.vk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  gr i n++++eg+er+ r  +   Wr+ + ++ + +v++ ++   qa+++l+k ++  +  +++++ ++l++ Wk+ p++s+S W+
  DCAR_012343 463 GRGIINCISTEGEERITRSVKIDVWRSYFARFQMVEVEVPKSSLRQAEMVLKKeFPcARFCTLNNDGKCLIIRWKGTPMFSLSTWK 548
                  *************************************************998626677878999*********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.598150526IPR005202Transcription factor GRAS
PfamPF035141.1E-81176548IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 561 aa     Download sequence    Send to blast
MSDDFGLSSP NLIQTEYRPL EVLEKEIYTQ AEQASISKIN VPEERNLVSI DLGHDINKGK  60
EADMGFGGAH HELPCSLSPE IDFPLKNKPD SNSASLFELL GRYEKRGKNL ADEHCNPSSE  120
ITTSSRKLST EEIIRVAAER YIEFPGKDLD CVTTFIHPYG SALSSLSLEE TRGADLAHLL  180
LAAADKIWDG KIDSARRLLM RCECKASKSG NPVERLASYF SEALQERIFR ETGSRRIKMV  240
SYEARTPNNG LSTGVDKTVL ATHDDIPFSK VMQFATTQTI LDHVAMETNI HIIDLHIRSG  300
IHWPPMIQAL SERKAHPIQH LKITALDTED KQKVEDICKR LESFANPLNI AFSFNVVTVD  360
DIRDLKKELF GIQAGEAVVI YAPTILRTMI PWPDKLETLM RVIGDIRPLL MIVQEVDAND  420
NSPSFINRFV EALFFYSTWF DCLEDCLDRS NQYRMTLENN YFGRGIINCI STEGEERITR  480
SVKIDVWRSY FARFQMVEVE VPKSSLRQAE MVLKKEFPCA RFCTLNNDGK CLIIRWKGTP  540
MFSLSTWKFQ EAPLYVELFD *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-2919954826375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017240062.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A161Y3310.0A0A161Y331_DAUCS; Uncharacterized protein
STRINGXP_009628660.11e-149(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17490.11e-46RGA-like protein 3