PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_012342
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 575aa    MW: 65164.7 Da    PI: 8.0524
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_012342genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2806.9e-862015721374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaalklfsevsPilkfshl 96 
                  l +lLl+ Ae v ++++ +a++lL + +  ++ +g p++R++ +f +AL++r++ ++ + +++ ++ + ++++   s + +   +++++ P+ ++ ++
  DCAR_012342 201 LAHLLLDSAEKVGNKQFDAANKLLLHSEGKVTDSGHPVERITYHFSKALRERITAETRTSVNQRETDQGRDYSglFSGVENTCLVLHQAVPFSQVMQF 298
                  579****************************************************666666666666666666542333333344************* PP

         GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlelee 193
                  +  q+Ile v++ +++H iD+++  G+QW++L+qaL++R+  +   l++T+++    ++ke+ e++g+rL+++A++l++ f f+++   +++dl++e 
  DCAR_012342 299 ASIQMILEHVATRKKIHLIDLQLRIGVQWAPLIQALSEREtFPVQLLKLTALQT---TDKEKAENIGKRLQDYAKSLNICFIFKAVSIVNMKDLKVEL 393
                  ****************************************4455699******9...68**************************9999********* PP

         GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellg 291
                  ++++pgEa++V + + l  +  ++ +l+     +L+++++++Pk++vv e ea+hns+sF++rf+eal ++sa fd+le  + r+++ r+++Er ++g
  DCAR_012342 394 FNIRPGEAVVVYSPIVLRAMIPKPENLQI----LLRVIQRMRPKIMVVNEVEANHNSPSFVNRFTEALFFFSAWFDALEDCIDRDNQYRMNIERSYFG 487
                  *********************88888888....***************************************************************** PP

         GRAS 292 reivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk..sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  r i+n++a+eg+ r+ r+ t++ Wr  ++++ + ++ +s+   +qa+l+l+k    ++  ++ ++ ++l+ gWk+ pL svSaW+
  DCAR_012342 488 RGIQNILATEGEGRIIRCVTMNVWRVFFQRFKMVEIDISKASINQANLVLEKKFccGNSCNIYKNGKCLIVGWKGTPLHSVSAWK 572
                  **************************************************9865356778999*********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.076175550IPR005202Transcription factor GRAS
PfamPF035142.4E-83201572IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 575 aa     Download sequence    Send to blast
MADDFSLFSV FDSQDVHKPL EGLLNDMLVT QQTQVSSFGS DIPGGVDHST TGIRSGRHPI  60
IIEEPRVHPS GDQEKCIFSN SNVSTIPEPD QLILKGQKYE QSSKDSDFIH LMPHKNCTES  120
FRVLGNYGKG KERCREDIFS GHSSKNTVTD HKLTTEEIMR VAGERFIHFS NKRFDGITSF  180
IHPDGSALSC LSSEDTRMVD LAHLLLDSAE KVGNKQFDAA NKLLLHSEGK VTDSGHPVER  240
ITYHFSKALR ERITAETRTS VNQRETDQGR DYSGLFSGVE NTCLVLHQAV PFSQVMQFAS  300
IQMILEHVAT RKKIHLIDLQ LRIGVQWAPL IQALSERETF PVQLLKLTAL QTTDKEKAEN  360
IGKRLQDYAK SLNICFIFKA VSIVNMKDLK VELFNIRPGE AVVVYSPIVL RAMIPKPENL  420
QILLRVIQRM RPKIMVVNEV EANHNSPSFV NRFTEALFFF SAWFDALEDC IDRDNQYRMN  480
IERSYFGRGI QNILATEGEG RIIRCVTMNV WRVFFQRFKM VEIDISKASI NQANLVLEKK  540
FCCGNSCNIY KNGKCLIVGW KGTPLHSVSA WKFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-3322957231375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ1501421e-147FJ150142.1 Daucus carota subsp. sativus clone BAC C107M02 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017240061.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A166CCJ50.0A0A166CCJ5_DAUCS; Uncharacterized protein
STRINGXP_009346627.11e-153(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-56RGA-like 1