PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_012341
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 576aa    MW: 65324.4 Da    PI: 6.6335
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_012341genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS276.96.3e-851955671374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalkl..fsevsPilkfsh 95 
                  l +lLl++A+ + +g++  a++lL++    as++g+p++Rla+y+ eAL++r++r ++s+   + + ++ +++n  ++   +++   +   P+ k  h
  DCAR_012341 195 LAHLLLAAADKILDGNFDSARRLLTNCDCKASKSGNPIERLASYISEALQERIHReKGSRKIGIASEKDRAPNNGLSTGLDQTVlaAHMKIPFSKALH 292
                  579****************************************************767777777777777778844444444442244558******* PP

         GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlele 192
                  ++  q+Ile v +e+ +HiiD+ i  G++Wp+++qaL++R+ ++   l+iT+++    ++k+++e +g+rL++fA++l++pf+f+v+++++++ l+ e
  DCAR_012341 293 FASTQTILEHVTTETSIHIIDLHIRSGIHWPPMIQALSERKvHQVQLLKITALDT---EDKQKVEDIGKRLESFADSLKIPFSFDVVTVDDMSYLRKE 387
                  *****************************************777789*******9...58************************************** PP

         GRAS 193 eLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErell 290
                   +++++gEa+++     l ++  ++ +le     +++++++l+P ++++ e +a+ ns+sF +rf+++l +ys+ fd+le  l r+++ r+++E+ ++
  DCAR_012341 388 LFDIQSGEAVVIFAPTLLRTMIPRPDKLET----LMRVIRELNPLIMIIYEVDANDNSTSFINRFVDSLFFYSTWFDCLEDCLDRDDQYRMNLEKYYF 481
                  ***************999999866555555....**************************************************************** PP

         GRAS 291 greivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrk.vk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  g  i+n +a+eg+er+ r  +   Wr+ + ++ + +v++  +   qa+++l+k ++  +  ++  +s+++++gWk+ p++s+S W+
  DCAR_012341 482 GSGIMNSIANEGEERITRSVKIDVWRSYFARFQMVEVEVPGSSFHQAEMVLKKeFScARFCTLSTDSKCFIIGWKGTPMFSLSTWK 567
                  *************************************************99862567777899**********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.532169545IPR005202Transcription factor GRAS
PfamPF035142.2E-82195567IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 576 aa     Download sequence    Send to blast
MSDDFGLSSP NIIQTDNRPL EVLENDIYTR VEHISTSKVK EPSERNPLCS GIMHGINEGK  60
MEDKGLIVSE NGMNNRNKAI RAQHYVGAYG EQPSSRAPEV YFPVKNKADF NSASLFELLS  120
RYERGGKKLK DENLSNRSKI ATSDQKLTTE EIIRVAAERY IQFQNKDLEG ITTFIHPRGS  180
VLSSLSVEET RGANLAHLLL AAADKILDGN FDSARRLLTN CDCKASKSGN PIERLASYIS  240
EALQERIHRE KGSRKIGIAS EKDRAPNNGL STGLDQTVLA AHMKIPFSKA LHFASTQTIL  300
EHVTTETSIH IIDLHIRSGI HWPPMIQALS ERKVHQVQLL KITALDTEDK QKVEDIGKRL  360
ESFADSLKIP FSFDVVTVDD MSYLRKELFD IQSGEAVVIF APTLLRTMIP RPDKLETLMR  420
VIRELNPLIM IIYEVDANDN STSFINRFVD SLFFYSTWFD CLEDCLDRDD QYRMNLEKYY  480
FGSGIMNSIA NEGEERITRS VKIDVWRSYF ARFQMVEVEV PGSSFHQAEM VLKKEFSCAR  540
FCTLSTDSKC FIIGWKGTPM FSLSTWKFKQ APSYF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-3221856726375GRAS family transcription factor containing protein, expressed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017240060.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A161WXY50.0A0A161WXY5_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-47RGA-like 1