PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_012340
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 576aa    MW: 65423.3 Da    PI: 4.9848
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_012340genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS268.62e-821955671374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal..ppsetsekn..sseelaalkl..fsevsPilk 92 
                  l +lLl++A+ + +g++  a++lL+  +  as++g+p++Rl++yf eAL++r+ r  +++ k+l  + ++ +++n  s  +   +++   +   P+ k
  DCAR_012340 195 LAHLLLAAADKFWDGEFDSARRLLTCCECKASKSGNPIERLTSYFSEALQERIRR-ETGTRKILmvSENDRAPNNglS--TGVDQTVlaTHMKIPFSK 289
                  579***************************************************9.5566666521333444444432..22222222245568**** PP

         GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl 189
                    h++  q+Ile v++e+++H+iD+ i  G++W +L+q L++R+ ++   l+iT+++    ++k+++e +g+rL+++A++l+++f+f+v+++++++ l
  DCAR_012340 290 ALHFASTQTILEHVARETKIHVIDLHIRSGIHWSPLIQGLSERKvHPVQLLKITALDT---EDKQKVEDIGKRLESLADSLNITFSFDVVTVDDMSHL 384
                  ********************************************5566699******9...58*********************************** PP

         GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEr 287
                  + e ++v++gEa++++    l ++  ++ +le+    +++++++lsP +++++e ea+ ns+sF +rf+eal +ys+ fd+le  l r+++ r+++E+
  DCAR_012340 385 KKELFDVQSGEAVVISAPTILRSMIPRPDKLEN----LMRVIRELSPLIMIISEVEANDNSPSFINRFVEALFFYSSWFDCLEDCLDRDNQYRMNLEK 478
                  ************************988888888....************************************************************* PP

         GRAS 288 ellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrk.vk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                   ++g  i+n +a+eg+er+ r  +   Wr+ ++++ + +v++ ++    a+++l++ ++  +  ++ ++ ++l++ Wk+ p++s+S W+
  DCAR_012340 479 YYFGCGIMNSIATEGEERITRSVKIDVWRSYFSRFQMLEVQVPKSSFHLAEMVLEMeFScARFCTLSNDGKCLMIRWKGTPMFSLSTWK 567
                  ******************************************************9735566778999*********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.731169545IPR005202Transcription factor GRAS
PfamPF035146.8E-80195567IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 576 aa     Download sequence    Send to blast
MSDDFGLPSS PIIQTDYRPP EVLENEFYTR VEQIPTSTVN EPSEKNPVCS DLGYGIYKGK  60
MTDTGLSVLE YDMENWNKAD TSEHYAGAYC EQPSSLAPEL DLPVQQKPDF SSATLFENLS  120
KYERAGKKLK DEQSSNLSEI ASVNQKLSTE EIIRAAAERY IQFPNKDPEC ITTFIHPHGS  180
VLSSLSKEES SGVDLAHLLL AAADKFWDGE FDSARRLLTC CECKASKSGN PIERLTSYFS  240
EALQERIRRE TGTRKILMVS ENDRAPNNGL STGVDQTVLA THMKIPFSKA LHFASTQTIL  300
EHVARETKIH VIDLHIRSGI HWSPLIQGLS ERKVHPVQLL KITALDTEDK QKVEDIGKRL  360
ESLADSLNIT FSFDVVTVDD MSHLKKELFD VQSGEAVVIS APTILRSMIP RPDKLENLMR  420
VIRELSPLIM IISEVEANDN SPSFINRFVE ALFFYSSWFD CLEDCLDRDN QYRMNLEKYY  480
FGCGIMNSIA TEGEERITRS VKIDVWRSYF SRFQMLEVQV PKSSFHLAEM VLEMEFSCAR  540
FCTLSNDGKC LMIRWKGTPM FSLSTWKFQQ PLIYF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3321856726375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017240059.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A166CCH90.0A0A166CCH9_DAUCS; Uncharacterized protein
STRINGVIT_07s0005g01500.t011e-145(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.14e-48RGA-like 2