PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_012253
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 652aa    MW: 73004.1 Da    PI: 5.69
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_012253genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS286.86.1e-881675401374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalkl...fsevsPilkfs 94 
                  l +lLl++Ae + +g+   a+++La  +  as +g+p++Rl++yf  AL++r++r ++s+  ++++ ++ +++     + ++++    +e  P+ k+ 
  DCAR_012253 167 LAHLLLSAAEKIWDGKIDSARRMLAFCQCKASRSGNPIERLTSYFSAALQERISReTGSRRISTISDNARTPNFNGLFTGVDQTavaIHEYIPFSKVL 264
                  579****************************************************777777777766666666544444444444569********** PP

         GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                  h++  q+Ile ve+e+ +H iD+ i  G+QWp+++qaL++R+  +   l+iT+++    ++k+ +e +g+rL++fA+ l+++f+fnv+ ++++++l+ 
  DCAR_012253 265 HFASTQTILEHVENETDIHLIDLHIRSGMQWPPMIQALSERKdYPIKYLKITALDT---VDKQIVEDIGKRLESFANPLNISFSFNVVSVDDISNLNK 359
                  *****************************************9666779*******9...79************************************* PP

         GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErel 289
                  e ++v++gEa+++     l ++l ++ ++e+    +++++k+l+P ++++ e ea+ ns+sF +rf+e+l +ys+ fd+le+ l r++++r+++Er++
  DCAR_012253 360 ELFDVQSGEAVVIYAPTILRTMLPRPDKMEN----LMRVIKELNPLIMILHEIEANDNSPSFINRFVETLFFYSTWFDCLEECLDRDNQHRKTLERHY 453
                  ***********************88888888....*************************************************************** PP

         GRAS 290 lgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrk.vk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  +gr i n +a+eg+er+ r  +l  Wr+ + ++ + +v++ e+   qa+ +l+k ++  +  ++ ++ ++l++ Wk+ p++s+S W+
  DCAR_012253 454 FGRGIINTLATEGEERITRSVKLDVWRSYFVRCQMVEVEVPESSFHQAEVVLKKgFScARFCTLSSDGKCLMIAWKGTPVFSLSTWK 540
                  **************************************************998736667778999*********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.89141518IPR005202Transcription factor GRAS
PfamPF035142.1E-85167540IPR005202Transcription factor GRAS
CDDcd017692.20E-7533591No hitNo description
Gene3DG3DSA:3.10.20.904.1E-9544591No hitNo description
PfamPF002405.1E-9544591IPR000626Ubiquitin domain
SuperFamilySSF542365.53E-9544591IPR029071Ubiquitin-related domain
PROSITE profilePS5005310.898545591IPR000626Ubiquitin domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 652 aa     Download sequence    Send to blast
MSGYIGISSS NIVQTGDNRP VEVLKEENFS RAVEVSVSRL EEPGEPSIDK GKIAEVGFGD  60
LVSPSLGPRV DSPAVKQRPG FGSASLFELL SRYERGGKRL SDHENLGNPS CESSSRQKLS  120
TEEIIRVAAE RYIEFPSKDL DCVTTFIHPY GSALSSLSLE ETSGADLAHL LLSAAEKIWD  180
GKIDSARRML AFCQCKASRS GNPIERLTSY FSAALQERIS RETGSRRIST ISDNARTPNF  240
NGLFTGVDQT AVAIHEYIPF SKVLHFASTQ TILEHVENET DIHLIDLHIR SGMQWPPMIQ  300
ALSERKDYPI KYLKITALDT VDKQIVEDIG KRLESFANPL NISFSFNVVS VDDISNLNKE  360
LFDVQSGEAV VIYAPTILRT MLPRPDKMEN LMRVIKELNP LIMILHEIEA NDNSPSFINR  420
FVETLFFYST WFDCLEECLD RDNQHRKTLE RHYFGRGIIN TLATEGEERI TRSVKLDVWR  480
SYFVRCQMVE VEVPESSFHQ AEVVLKKGFS CARFCTLSSD GKCLMIAWKG TPVFSLSTWK  540
FEQNSDTVES VKKQIANENG VAVADVEELR LAFAGRELED HRVIGDYPIH NVEAQVGAGF  600
QGLGIIKRTL SFGFLYLVIS AGSLAVCNKR LVLYIVVVRQ VLIGTGWKFE L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-3519054026375GRAS family transcription factor containing protein, expressed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017240025.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A161Y2V00.0A0A161Y2V0_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-50RGA-like 1