PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_011845
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 179aa    MW: 19913.7 Da    PI: 6.9304
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_011845genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.71.1e-4471061100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +Ca+Ck+lrr+C+kdC++apyfp+++p+kfa+vhk+FGasn++k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +la+++
  DCAR_011845   7 PCASCKLLRRRCTKDCTFAPYFPSDDPHKFAIVHKVFGASNISKMLQELPIHQRADAVSSLVYEANARVRDPVYGCVGAISYLQNQVSQLQMQLAVAQ 104
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  DCAR_011845 105 TE 106
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.5876107IPR004883Lateral organ boundaries, LOB
PfamPF031953.8E-447104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MGTGHSPCAS CKLLRRRCTK DCTFAPYFPS DDPHKFAIVH KVFGASNISK MLQELPIHQR  60
ADAVSSLVYE ANARVRDPVY GCVGAISYLQ NQVSQLQMQL AVAQTEMLCI QMQQEQPPLL  120
PPSMEPISAH DLIGDDKSSF YSNNMMPQYL NYSSSNSTNV IHDSLKRESF FGHDMHVS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-4921087112LOB family transfactor Ramosa2.1
5ly0_B9e-4921087112LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017241428.11e-132PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW31e-72LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A166BZK41e-131A0A166BZK4_DAUCS; Uncharacterized protein
STRINGVIT_13s0067g01880.t011e-91(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-71LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]