PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_011833
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 350aa    MW: 39139.5 Da    PI: 8.6965
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_011833genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like986.9e-3172125255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  prlrWtp+LH++F++av++LGG+e+AtPk +l++m++kgL+++hvkSHLQ++R+
  DCAR_011833  72 PRLRWTPDLHRCFIQAVDKLGGQERATPKLVLQMMNIKGLSISHVKSHLQMHRS 125
                  9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-2868126IPR009057Homeodomain-like
PROSITE profilePS5129412.22668128IPR017930Myb domain
SuperFamilySSF466897.88E-1569126IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-2371127IPR006447Myb domain, plants
PfamPF002494.3E-973124IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MKETSDTNSE DWKTISYDNI DKEEDGGGSE EKLVCARKNG GISSSNSTVE ESEKSTKGAS  60
GSVRQYNRSK NPRLRWTPDL HRCFIQAVDK LGGQERATPK LVLQMMNIKG LSISHVKSHL  120
QMHRSKKMED PDEVLSEPGL LGTRDYNHHI YNFSQLPMLQ GSGHSPNSRR YANEPWSRHN  180
NPTYTSFMGG FGSSSFKQSL LQPMPAKNNF GTAGSTSHTL GFDFYRTNLS FSAEDQPRVC  240
RNQESFRSHL IQLNMHKEQQ DRGGNNEVIT PKAQKRKAAE NSDSELDLNL SLKQPEKQEA  300
NDKLEASSLS LCLFSSSASN CTSRLEERDM SITGKKHARR MASSLDLTL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-1773127357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-1773127357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-1773127357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-1773127357Protein PHOSPHATE STARVATION RESPONSE 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017241059.10.0PREDICTED: putative Myb family transcription factor At1g14600
TrEMBLA0A161Y1N40.0A0A161Y1N4_DAUCS; Uncharacterized protein
STRINGXP_004307667.13e-58(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA85732129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.14e-43G2-like family protein