PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_011832
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 167aa    MW: 18405.2 Da    PI: 6.4998
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_011832genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.31.6e-40111101100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +C+aCk+l+r+C+++C +apyfp+++pkkf  vhk+FGasnv+k+l+++ +e+reda+++lv+eAear++dPvyG++g i +lq +++ql+++la++k
  DCAR_011832  11 SCSACKLLKRRCVPNCLFAPYFPSDEPKKFVKVHKVFGASNVSKILNEVVKEQREDAVNTLVFEAEARLKDPVYGCIGEIASLQGKMAQLQHDLAVAK 108
                  6**********************************************************************************************998 PP

       DUF260  99 ee 100
                  ++
  DCAR_011832 109 AR 110
                  75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.65210111IPR004883Lateral organ boundaries, LOB
PfamPF031959.9E-4011108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MRSQEPRSTS SCSACKLLKR RCVPNCLFAP YFPSDEPKKF VKVHKVFGAS NVSKILNEVV  60
KEQREDAVNT LVFEAEARLK DPVYGCIGEI ASLQGKMAQL QHDLAVAKAR LAHCAVVKAS  120
TSLLPVDDQL EMLPFNPVYD GFFDGQVFDI DQTHVVDGFS EAPFLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-4361266128LOB family transfactor Ramosa2.1
5ly0_B3e-4361266128LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017242719.11e-120PREDICTED: LOB domain-containing protein 21-like
SwissprotQ9SRL82e-57LBD21_ARATH; LOB domain-containing protein 21
TrEMBLA0A166BZA21e-119A0A166BZA2_DAUCS; Uncharacterized protein
STRINGVIT_13s0067g01450.t012e-64(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.17e-60LOB domain-containing protein 21
Publications ? help Back to Top
  1. Weber AP,Weber KL,Carr K,Wilkerson C,Ohlrogge JB
    Sampling the Arabidopsis transcriptome with massively parallel pyrosequencing.
    Plant Physiol., 2007. 144(1): p. 32-42
    [PMID:17351049]