PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_011611
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family bZIP
Protein Properties Length: 187aa    MW: 21060.1 Da    PI: 10.1406
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_011611genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.31.8e-14109153852
                  HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                   r++kNRe+A rsR RK+a++++L +  ++L+aeN +Lk + + l
  DCAR_011611 109 QRLIKNRESAARSRDRKQAYTAQLVQQLQTLKAENAKLKMKQQAL 153
                  699***********************************9887766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-9102166IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.278104153IPR004827Basic-leucine zipper domain
CDDcd147072.25E-14106157No hitNo description
SuperFamilySSF579593.13E-11108156No hitNo description
PfamPF001707.4E-13108153IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.8E-13108153No hitNo description
PROSITE patternPS000360110124IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MEEIWKDIPN LSSLGNPNNT FDGVKLQESA FLNPNYNLNP VLLPASNNVV LLTPQPNSFS  60
SSSCHQPMTL ELCMQSSGSS ARRKRFSISR ENDDQNNISS SSPTHRCNQR LIKNRESAAR  120
SRDRKQAYTA QLVQQLQTLK AENAKLKMKQ QALPDPILSF PHYSAIKFTL LLTIHIICSY  180
MRQLKL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017239878.11e-106PREDICTED: bZIP transcription factor 27-like
TrEMBLA0A161WVW31e-134A0A161WVW3_DAUCS; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.13e-11bZIP family protein