PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_010997
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family bZIP
Protein Properties Length: 163aa    MW: 19106.3 Da    PI: 5.2848
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_010997genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.81.5e-1585143563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  +++rr+++NRe+ArrsR RK+++++eL   v  L +eN+ L+++l++ +++ ++  +e+
  DCAR_010997  85 RKQRRMISNRESARRSRMRKQKQLDELWSQVVWLRNENQHLIEKLNKFSEQHDQALQEN 143
                  689***********************************************999988887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-1281145IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.79583146IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.55E-1285135No hitNo description
Gene3DG3DSA:1.20.5.1702.6E-1285158No hitNo description
PfamPF001701.2E-1385143IPR004827Basic-leucine zipper domain
CDDcd147021.48E-1886137No hitNo description
PROSITE patternPS00036088103IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MQTSEMAELH YLVPPDPITL LPSTFSCSQN NTPTFDQFTR FSNPLLYDLQ TNPQLQSFNP  60
QPTSFSSNST SDEADEKQIC LINERKQRRM ISNRESARRS RMRKQKQLDE LWSQVVWLRN  120
ENQHLIEKLN KFSEQHDQAL QENAQLKDET SELRQMLSDM QL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
197104RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017240946.11e-115PREDICTED: basic leucine zipper 43-like
TrEMBLA0A162AK441e-114A0A162AK44_DAUCS; Uncharacterized protein
STRINGVIT_14s0083g00700.t016e-66(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9472492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.15e-47basic leucine-zipper 42