PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_010924
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 365aa    MW: 40809.1 Da    PI: 7.8651
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_010924genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.7e-32242297156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k r++W+peLH+rFv+a++qLGG+++AtPk+i+e+m+v++Lt+++vkSHLQkYRl+
  DCAR_010924 242 KRRRCWSPELHRRFVNALQQLGGPHVATPKQIREVMQVNDLTNDEVKSHLQKYRLH 297
                  689***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.576239299IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-28240300IPR009057Homeodomain-like
SuperFamilySSF466897.62E-17241300IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-27242297IPR006447Myb domain, plants
PfamPF002494.5E-7244295IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MGVNSPLSEP EFDLNSSFVP VNISEFLKEI SVITDVSERA MKMDDYVLQL QDELNKVHAF  60
KRELPLCMLL LNDAIERLKE EKMKCGEIET GPLIEEFMTL KGGKSDENGG VIKSIDCSEK  120
KNWMSSVQLW STNVQFHNFG HDFLSNLKSK VREEDGSRSS GGYDETRDKL QSSGGAFVPF  180
KRQSGQIVKE KIDNLLKEKN KTLPVNNLSL RVPMVEIGSI DRNSKGNVRG TSRSDSALPE  240
RKRRRCWSPE LHRRFVNALQ QLGGPHVATP KQIREVMQVN DLTNDEVKSH LQKYRLHVRK  300
VPAAKLNCPW FGQDQHISMS NSSISQSGSP EGPLGCGKGV STTGGDSMEE EEKSEGRNWK  360
GSSN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1240244RKRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00629PBMTransfer from PK14402.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017241901.10.0PREDICTED: uncharacterized protein LOC108214423 isoform X1
TrEMBLA0A166AZY80.0A0A166AZY8_DAUCS; Uncharacterized protein
STRINGXP_004288067.11e-101(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA84972229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.12e-50G2-like family protein