PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_010922
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 297aa    MW: 32836 Da    PI: 6.8347
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_010922genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.91.8e-4371061100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv kll++l+  +reda++sl+yeA+ar+rdPvyG+vg+i+ lq++l+q++++l  +k
  DCAR_010922   7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKLLNDLNAAQREDAVNSLAYEADARLRDPVYGCVGLISILQHKLKQVQVDLFNAK 104
                  7********************************************************************************************98888 PP

       DUF260  99 ee 100
                  +e
  DCAR_010922 105 KE 106
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8146107IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-437103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFANVH KVFGASNVAK LLNDLNAAQR  60
EDAVNSLAYE ADARLRDPVY GCVGLISILQ HKLKQVQVDL FNAKKELASY IGPSAMLPIL  120
QHPGLIQQHP SNPQNVLGYN NMQPMLGLSM NQPHGAMPLM IRDPQQQQML EAQHLAAAER  180
EQAEIMRTYN EQQQPPPDQH PRFNNGFDTS GQTAASGFNQ TIADGSTMSL VLGSYENQYG  240
HHPIQQQPQE PHIHHNQVLQ IQPQLLLQQQ QQIAPPQAVT QHRDGSEEGR SGGPSC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-4841108114LOB family transfactor Ramosa2.1
5ly0_B5e-4841108114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017240569.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ32e-77LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A166AZW50.0A0A166AZW5_DAUCS; Uncharacterized protein
STRINGXP_009774046.11e-103(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.16e-80ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]