PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_010829
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 424aa    MW: 47381.3 Da    PI: 5.6279
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_010829genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS305.71.1e-93314202373
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl..fsevsPilkfshlt 97 
                  ++ L++cA+a++++d++laq++L+ l+++a +dgd++qRla  f++AL ar ar  ++++k+l+   ++ + +++++++ +l  f++++P+++f++ +
  DCAR_010829  31 EQMLVHCANAIENNDATLAQQILWVLNNIAPSDGDSNQRLACGFLRALIARAAR--KGTCKILTGAVANVHITTHKFSVIELtgFVDLTPWHRFGFTA 126
                  789***************************************************..8999999888887777777777777788************** PP

         GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefnvl.......vakr 185
                  aN aIl+aveg + vHiiDf++++++Q p+L++a+a+R egpp +++T+ g+ e +      ++ee+g +L +fA++ +v +ef+v+        a+ 
  DCAR_010829 127 ANAAILDAVEGYSIVHIIDFSLTHCMQIPTLIDAIANRLEGPPLVKLTVAGATEDVppmLDLSYEELGMKLVNFARSRNVILEFRVIpstssngFASF 224
                  ****************************************************887798888999**********************988544444444 PP

         GRAS 186 ledleleeLrvkp.......gEalaVnlvlqlhrll........desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                       +e+L+v++        Eal++n++++lh+++         ++++++s r+ +Lk ++sl P+vvv+v+++ad +s++++ r+  a++y +  +
  DCAR_010829 225 -----IEQLKVQNlvpvnngIEALVINCHMMLHYIPeetlnpfsFNNTAVSSLRTMFLKELRSLDPTVVVLVDEDADFTSNNLVSRLRAAFNYLWIPY 317
                  .....5555555555555789***************444444443334455589******************************************** PP

         GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366
                  d++++ lp+ s++r+++E+  ++++i+nv+a eg er+er e +++W +r+++aGF+   ++e+a++++k++l +++  g+ ++ e++ lvl+Wk+++
  DCAR_010829 318 DTVDTFLPQGSKQRQWYEAD-MNWKIENVIAEEGVERVERLEPKSRWVQRMRNAGFRGGLFGEEAVMEVKSMLDEHA-AGWGLKREEEDLVLTWKGHN 413
                  ********************.********************************************************.8999**************** PP

         GRAS 367 LvsvSaW 373
                  +v+++aW
  DCAR_010829 414 VVFATAW 420
                  ******* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.7354402IPR005202Transcription factor GRAS
PfamPF035143.7E-9131420IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MSKNQIVRPR QWPGFQTSKS IGSFGDANCM EQMLVHCANA IENNDATLAQ QILWVLNNIA  60
PSDGDSNQRL ACGFLRALIA RAARKGTCKI LTGAVANVHI TTHKFSVIEL TGFVDLTPWH  120
RFGFTAANAA ILDAVEGYSI VHIIDFSLTH CMQIPTLIDA IANRLEGPPL VKLTVAGATE  180
DVPPMLDLSY EELGMKLVNF ARSRNVILEF RVIPSTSSNG FASFIEQLKV QNLVPVNNGI  240
EALVINCHMM LHYIPEETLN PFSFNNTAVS SLRTMFLKEL RSLDPTVVVL VDEDADFTSN  300
NLVSRLRAAF NYLWIPYDTV DTFLPQGSKQ RQWYEADMNW KIENVIAEEG VERVERLEPK  360
SRWVQRMRNA GFRGGLFGEE AVMEVKSMLD EHAAGWGLKR EEEDLVLTWK GHNVVFATAW  420
IPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B1e-441642373475Protein SHORT-ROOT
5b3h_B4e-451642319421Protein SHORT-ROOT
5b3h_E4e-451642319421Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017240744.10.0PREDICTED: scarecrow-like protein 32
SwissprotQ9SN220.0SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A161WTQ40.0A0A161WTQ4_DAUCS; Uncharacterized protein
STRINGEOX916400.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA87812429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.10.0GRAS family protein