PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_010820
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 523aa    MW: 58715.6 Da    PI: 5.9012
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_010820genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3511.9e-1071445213374
         GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                  + Lle+A+av+++++++ q+l++ l+el+sp+gd+ q+la+yf++AL +r+++s+++ y++l ++++++ + + + + +  f+evsP+ +f+h+++N 
  DCAR_010820 144 DILLEAARAVAEKNTTRLQQLVWMLNELSSPYGDTDQKLASYFLQALFSRMTDSGERSYRTLVSTSEKNCSFEATRKTVLKFQEVSPWTTFGHVACNG 241
                  679*********************************************************998777764443333344444***************** PP

         GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg......skeeleetgerLakfAeelgvpfefnvlvak.rledlel 191
                  aI+ea+ege+++HiiDf+ ++++QWp+Ll+aLa+R++++p+lR+T+v++++++       ++ ++e+g+r++kfA+ +gvpf+f++++++ +l++l+l
  DCAR_010820 242 AIMEAFEGESKLHIIDFSNTYCTQWPTLLEALATRTDETPHLRLTTVVANKASgpgtaaVHKVMREIGNRMEKFARLMGVPFKFSIIHHTgDLSELNL 339
                  ***********************************************99888789999999**************************8878******* PP

         GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnse....sFlerflealeyysalfdsleaklpreseerikv 285
                   eL++k++Ea+aVn+v +lh++     ++ ++rd +++++++l+P++++vve+ead++ +    +Fl++f e+l+++ + f+sl+  ++++s+er ++
  DCAR_010820 340 AELDIKEDEAVAVNCVGALHSVQ----AVGNRRDYMISMFRRLQPRIITVVEEEADLDVGvdgfDFLRGFQECLRWFRVYFESLDDCFSKTSNERLML 433
                  **********************8....8888899********************99865556669********************************* PP

         GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve.eesgslvlgWkdrpLvsvSaWr 374
                  Er+  gr++v++vac  +e++er+e + +W++rl+ aG+ ++++s+++ +++++llr++k +g+++  ++++ ++l Wkd+++v++SaW+
  DCAR_010820 434 ERA-AGRAVVDLVACPPSESIERREPATRWSHRLHGAGYAAASFSDEVCDDVRALLRRYK-EGWTMApCSDAGIFLLWKDQAVVWASAWK 521
                  ***.********************************************************.89888868899999**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098550.119116501IPR005202Transcription factor GRAS
PfamPF035146.5E-105144521IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009956Biological Processradial pattern formation
GO:0045930Biological Processnegative regulation of mitotic cell cycle
GO:0048366Biological Processleaf development
GO:0055072Biological Processiron ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
MDTLFRLVST LQPDQQSFNS SRTSSSSRSI SHQNPPHYQV DEECFNVFMD EEDLSSSSSK  60
HNNSNYYPPS TYIQQQYHHQ LPLSNTPTPT TTNTSTPPHQ YQHHQSSGGA GFETSSADHY  120
SYSSAHDLTL EFGSLVSGGK WASDILLEAA RAVAEKNTTR LQQLVWMLNE LSSPYGDTDQ  180
KLASYFLQAL FSRMTDSGER SYRTLVSTSE KNCSFEATRK TVLKFQEVSP WTTFGHVACN  240
GAIMEAFEGE SKLHIIDFSN TYCTQWPTLL EALATRTDET PHLRLTTVVA NKASGPGTAA  300
VHKVMREIGN RMEKFARLMG VPFKFSIIHH TGDLSELNLA ELDIKEDEAV AVNCVGALHS  360
VQAVGNRRDY MISMFRRLQP RIITVVEEEA DLDVGVDGFD FLRGFQECLR WFRVYFESLD  420
DCFSKTSNER LMLERAAGRA VVDLVACPPS ESIERREPAT RWSHRLHGAG YAAASFSDEV  480
CDDVRALLRR YKEGWTMAPC SDAGIFLLWK DQAVVWASAW KP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B0.013752282474Protein SHORT-ROOT
5b3h_B0.013752228420Protein SHORT-ROOT
5b3h_E0.013752228420Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for quiescent center cells specification and maintenance of surrounding stem cells, and for the asymmetric cell division involved in radial pattern formation in roots. Essential for both cell division and cell specification. Regulates the radial organization of the shoot axial organs and is required for normal shoot gravitropism. Directly controls the transcription of SCR, and when associated with SCR, of MGP, RLK, TRI, NUC and SCL3. {ECO:0000269|PubMed:10850497, ECO:0000269|PubMed:12569126, ECO:0000269|PubMed:15314023, ECO:0000269|PubMed:16640459, ECO:0000269|PubMed:17446396, ECO:0000269|PubMed:9670559}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017237734.10.0PREDICTED: protein SHORT-ROOT
SwissprotQ9SZF70.0SHR_ARATH; Protein SHORT-ROOT
TrEMBLA0A166AXH40.0A0A166AXH4_DAUCS; Uncharacterized protein
STRINGVIT_07s0129g00030.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20312464
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.10.0GRAS family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Muraro D, et al.
    Integration of hormonal signaling networks and mobile microRNAs is required for vascular patterning in Arabidopsis roots.
    Proc. Natl. Acad. Sci. U.S.A., 2014. 111(2): p. 857-62
    [PMID:24381155]
  3. Tian H,Jia Y,Niu T,Yu Q,Ding Z
    The key players of the primary root growth and development also function in lateral roots in Arabidopsis.
    Plant Cell Rep., 2014. 33(5): p. 745-53
    [PMID:24504658]
  4. Gao X,Wang C,Cui H
    Identification of bundle sheath cell fate factors provides new tools for C3-to-C4 engineering.
    Plant Signal Behav, 2018.
    [PMID:24819776]
  5. Ahrazem O, et al.
    Ectopic expression of a stress-inducible glycosyltransferase from saffron enhances salt and oxidative stress tolerance in Arabidopsis while alters anchor root formation.
    Plant Sci., 2015. 234: p. 60-73
    [PMID:25804810]
  6. Jia Y, et al.
    The Arabidopsis thaliana elongator complex subunit 2 epigenetically affects root development.
    J. Exp. Bot., 2015. 66(15): p. 4631-42
    [PMID:25998905]
  7. Zhang M, et al.
    A tetratricopeptide repeat domain-containing protein SSR1 located in mitochondria is involved in root development and auxin polar transport in Arabidopsis.
    Plant J., 2015. 83(4): p. 582-99
    [PMID:26072661]
  8. Moreno-Risueno MA, et al.
    Transcriptional control of tissue formation throughout root development.
    Science, 2015. 350(6259): p. 426-30
    [PMID:26494755]
  9. Miguel A,Milhinhos A,Novák O,Jones B,Miguel CM
    The SHORT-ROOT-like gene PtSHR2B is involved in Populus phellogen activity.
    J. Exp. Bot., 2016. 67(5): p. 1545-55
    [PMID:26709311]
  10. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  11. Kim ES, et al.
    HAWAIIAN SKIRT regulates the quiescent center-independent meristem activity in Arabidopsis roots.
    Physiol Plant, 2016. 157(2): p. 221-33
    [PMID:26968317]
  12. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  13. Li Q,Zhao Y,Yue M,Xue Y,Bao S
    The Protein Arginine Methylase 5 (PRMT5/SKB1) Gene Is Required for the Maintenance of Root Stem Cells in Response to DNA Damage.
    J Genet Genomics, 2016. 43(4): p. 187-97
    [PMID:27090604]
  14. Clark NM, et al.
    Tracking transcription factor mobility and interaction in Arabidopsis roots with fluorescence correlation spectroscopy.
    Elife, 2017.
    [PMID:27288545]
  15. Yoon EK, et al.
    Conservation and Diversification of the SHR-SCR-SCL23 Regulatory Network in the Development of the Functional Endodermis in Arabidopsis Shoots.
    Mol Plant, 2016. 9(8): p. 1197-1209
    [PMID:27353361]
  16. Waszczak C, et al.
    SHORT-ROOT Deficiency Alleviates the Cell Death Phenotype of the Arabidopsis catalase2 Mutant under Photorespiration-Promoting Conditions.
    Plant Cell, 2016. 28(8): p. 1844-59
    [PMID:27432873]
  17. Yu Q, et al.
    A P-Loop NTPase Regulates Quiescent Center Cell Division and Distal Stem Cell Identity through the Regulation of ROS Homeostasis in Arabidopsis Root.
    PLoS Genet., 2016. 12(9): p. e1006175
    [PMID:27583367]
  18. Sparks EE, et al.
    Establishment of Expression in the SHORTROOT-SCARECROW Transcriptional Cascade through Opposing Activities of Both Activators and Repressors.
    Dev. Cell, 2016. 39(5): p. 585-596
    [PMID:27923776]
  19. Hirano Y, et al.
    Structure of the SHR-SCR heterodimer bound to the BIRD/IDD transcriptional factor JKD.
    Nat Plants, 2017. 3: p. 17010
    [PMID:28211915]
  20. Henry S, et al.
    SHR overexpression induces the formation of supernumerary cell layers with cortex cell identity in rice.
    Dev. Biol., 2017. 425(1): p. 1-7
    [PMID:28263767]
  21. Möller BK, et al.
    Auxin response cell-autonomously controls ground tissue initiation in the early Arabidopsis embryo.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(12): p. E2533-E2539
    [PMID:28265057]
  22. Kobayashi A,Miura S,Kozaki A
    INDETERMINATE DOMAIN PROTEIN binding sequences in the 5'-untranslated region and promoter of the SCARECROW gene play crucial and distinct roles in regulating SCARECROW expression in roots and leaves.
    Plant Mol. Biol., 2017. 94(1-2): p. 1-13
    [PMID:28324206]
  23. Díaz-Triviño S,Long Y,Scheres B,Blilou I
    Analysis of a Plant Transcriptional Regulatory Network Using Transient Expression Systems.
    Methods Mol. Biol., 2017. 1629: p. 83-103
    [PMID:28623581]
  24. Long Y, et al.
    In vivo FRET-FLIM reveals cell-type-specific protein interactions in Arabidopsis roots.
    Nature, 2017. 548(7665): p. 97-102
    [PMID:28746306]
  25. Yu Q, et al.
    Cell-Fate Specification in Arabidopsis Roots Requires Coordinative Action of Lineage Instruction and Positional Reprogramming.
    Plant Physiol., 2017. 175(2): p. 816-827
    [PMID:28821591]
  26. Spiegelman Z,Lee CM,Gallagher KL
    KinG Is a Plant-Specific Kinesin That Regulates Both Intra- and Intercellular Movement of SHORT-ROOT.
    Plant Physiol., 2018. 176(1): p. 392-405
    [PMID:29122988]
  27. Bustillo-Avendaño E, et al.
    Regulation of Hormonal Control, Cell Reprogramming, and Patterning during De Novo Root Organogenesis.
    Plant Physiol., 2018. 176(2): p. 1709-1727
    [PMID:29233938]