PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_010666
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 591aa    MW: 65574.1 Da    PI: 7.8344
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_010666genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS339.75e-1042275902374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                  ++ L+e+A+a+s+g+l  a+++L+r+s+ ++++g++ +Rl ay+  AL++rl++       + +p++      ++++a+ ++++evsP++k+++++aN
  DCAR_010666 227 KQSLTEAATAISEGKLDIANEILTRVSKVSNKQGTAEERLMAYMCSALKTRLNQ-------TENPQDLY---GKDHMASIQMLYEVSPCFKLGFMAAN 314
                  689**************************************************9.......33444444...99************************ PP

         GRAS 100 qaIleavege...ervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlele 192
                   aIlea+  +     +H+iDfdi+q +Q++ Ll+aLa+++  +    l+iT++ +     ++ l+++g+ L+ +A+++gv+++f+v +  +++dl++ 
  DCAR_010666 315 LAILEALPDDennVNLHVIDFDIGQAGQYIHLLHALAAKRtaNRVIALKITTFLD----YATDLKAVGDGLKVLASKVGVNLSFRV-MNLNINDLNIG 407
                  *******665422456*********************6663445559********....99************************9.799******** PP

         GRAS 193 eLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErell 290
                  ++ ++ gE laVn++++l++l+desvs+e+ rde+L+ vk+lsPkvv++veqe++ n++sF++r+ e++ yy alf+sl+a++pr++ er+k+E+  l
  DCAR_010666 408 SFGLEVGEILAVNFAFRLYKLPDESVSTENLRDELLRRVKNLSPKVVTLVEQEMNANTASFVARVNETCGYYGALFESLDATVPRNKPERVKIEEG-L 504
                  ************************************************************************************************.* PP

         GRAS 291 greivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk..sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  +r+ +n vaceg++r+er+e l+kWr+r+++aGF++ +ls+k  ++ +  l+     + g++++ee g + +gW++r+L+++SaWr
  DCAR_010666 505 SRKMSNSVACEGRDRVERCEVLGKWRARMRMAGFEEKRLSQKLGESLRVKLNSGTrvNPGFTIKEEAGGISFGWMGRTLTVASAWR 590
                  ************************************************99987665789**************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.226200568IPR005202Transcription factor GRAS
PfamPF035141.7E-101227590IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 591 aa     Download sequence    Send to blast
MASGFSGGYS DFSISGSMNT RSVNDPRRPY MSNLAGMDSD VSSQMFNRRP EPTGKRSLSE  60
FQQHFQQQQQ LALYLRNVKQ RASYQQNASP ISPLSPPVDF YGHSQSPDIS SLSSNSAYRI  120
PIFQQLRQHQ QQQQQRQQHQ HVNNMILSAK PEAPAEKNMM HRLQELEKAL LDDDEDQNDV  180
VAATSVVTNS EWSDTIQRLI GTDHTTVSPS PASSSSSCSS PSIICAKQSL TEAATAISEG  240
KLDIANEILT RVSKVSNKQG TAEERLMAYM CSALKTRLNQ TENPQDLYGK DHMASIQMLY  300
EVSPCFKLGF MAANLAILEA LPDDENNVNL HVIDFDIGQA GQYIHLLHAL AAKRTANRVI  360
ALKITTFLDY ATDLKAVGDG LKVLASKVGV NLSFRVMNLN INDLNIGSFG LEVGEILAVN  420
FAFRLYKLPD ESVSTENLRD ELLRRVKNLS PKVVTLVEQE MNANTASFVA RVNETCGYYG  480
ALFESLDATV PRNKPERVKI EEGLSRKMSN SVACEGRDRV ERCEVLGKWR ARMRMAGFEE  540
KRLSQKLGES LRVKLNSGTR VNPGFTIKEE AGGISFGWMG RTLTVASAWR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3722559011375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017243472.10.0PREDICTED: scarecrow-like protein 8
TrEMBLA0A169WC760.0A0A169WC76_DAUCS; Uncharacterized protein
STRINGGorai.007G012300.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA40232443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.11e-134SCARECROW-like 8