PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_010011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 588aa    MW: 65947 Da    PI: 6.4725
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_010011genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS425.25.3e-1302175861373
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++lL++cA+ +s++     ++l+++++  +s +gdp+qRl ay++e+L ar  +s++++y+al+++e +    ++ l+++++++e++P+lkf++++a
  DCAR_010011 217 LKQLLVACARSLSENRVDDFDKLIETVRSAVSITGDPIQRLGAYMVEGLVARKEESGHNIYRALRCREPE---GKDLLSYMHILYEICPYLKFGYMAA 311
                  689******************************************************************9...9************************ PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                  N aI ea  +eer+HiiDf+i qG+QW++LlqaLa+Rp+g+p +RiTg+++p s+  + +++e++g+rL+ + e++++p+ef++ +     d++ ++L
  DCAR_010011 312 NGAIAEACRNEERIHIIDFQIAQGTQWMTLLQALAARPKGAPYVRITGIDDPVSKyaRGDSVEAVGRRLQALSEKFNIPVEFHA-MPVFAPDVTKDML 408
                  ****************************************************999999**************************.6888999****** PP

         GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                   v+pgEal+Vn+ lqlh+++desv+++++rd +L+++kslsPkvv++veqe+++n+++Fl rf+ealeyy+a+f+s++++lpr+ +eri+vE+++l+r
  DCAR_010011 409 GVRPGEALVVNFPLQLHHTPDESVDVNNPRDGLLRTIKSLSPKVVTLVEQESNTNTAPFLPRFVEALEYYAAMFESIDVSLPRDRKERINVEQHCLAR 506
                  ************************************************************************************************** PP

         GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                  +ivnv+aceg++r+erhe l+kW++rl++aGFk+ pls ++++ ++ ll+ ++ + y++ee +g+++lgWkdr+L+s+SaW
  DCAR_010011 507 DIVNVIACEGKQRVERHELLGKWKSRLTMAGFKQFPLSPYVNSVIRGLLKSYS-EHYKLEEIDGAMLLGWKDRNLISASAW 586
                  *****************************************************.55************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.511191568IPR005202Transcription factor GRAS
PfamPF035141.8E-127217586IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 588 aa     Download sequence    Send to blast
MDSDHLLSYR VNNTGVSYSS HPSIPTRLFG SLKFDTRNSP NSPFSNHFDC ETNTILSDTQ  60
EQYSSTENHS LSGTENHSFS SSGASPSCNS SHENSNSFQR SHDSSPFFSG EISFVQDTNN  120
GHNVHHALQN LETALMGPDE DEVTRPDSSW ARNQGPHISG RRSITMSQDQ MMPQIFQSQP  180
LQASYGSTYG QGDRMRTEKR QRSVEDVSLQ GYLPSNLKQL LVACARSLSE NRVDDFDKLI  240
ETVRSAVSIT GDPIQRLGAY MVEGLVARKE ESGHNIYRAL RCREPEGKDL LSYMHILYEI  300
CPYLKFGYMA ANGAIAEACR NEERIHIIDF QIAQGTQWMT LLQALAARPK GAPYVRITGI  360
DDPVSKYARG DSVEAVGRRL QALSEKFNIP VEFHAMPVFA PDVTKDMLGV RPGEALVVNF  420
PLQLHHTPDE SVDVNNPRDG LLRTIKSLSP KVVTLVEQES NTNTAPFLPR FVEALEYYAA  480
MFESIDVSLP RDRKERINVE QHCLARDIVN VIACEGKQRV ERHELLGKWK SRLTMAGFKQ  540
FPLSPYVNSV IRGLLKSYSE HYKLEEIDGA MLLGWKDRNL ISASAWH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-612195876375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269|PubMed:12591613}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269|PubMed:12591613}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017242159.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_017242160.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLA0A161XXB20.0A0A161XXB2_DAUCS; Uncharacterized protein
STRINGGorai.002G080600.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34412448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-176GRAS family protein
Publications ? help Back to Top
  1. Day RB, et al.
    Two rice GRAS family genes responsive to N -acetylchitooligosaccharide elicitor are induced by phytoactive gibberellins: evidence for cross-talk between elicitor and gibberellin signaling in rice cells.
    Plant Mol. Biol., 2004. 54(2): p. 261-72
    [PMID:15159627]