PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_009909
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family CO-like
Protein Properties Length: 368aa    MW: 40653.9 Da    PI: 7.412
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_009909genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box26.71.1e-082052335
     zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHk 35
                 ++ C++++ + + lfC+++++++C dC + +H 
  DCAR_009909 20 AKPCDTCKINAAVLFCRTDSTYMCMDCDSRIHG 52
                 578*****999*********************5 PP

2zf-B_box20.41.1e-0659104342
     zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                   ++C+ +e+ + +  C+ +   lC  C   +H+       H++vp+
  DCAR_009909  59 VWMCEVCEHAPSSVTCKADAAALCVMCDWDIHSAnplarrHERVPV 104
                  689*****************************66899999999986 PP

3CCT68.41.9e-23293336144
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                  R+a+++RY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  DCAR_009909 293 RKARVMRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 336
                  9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.3991851IPR000315B-box-type zinc finger
SMARTSM003360.051851IPR000315B-box-type zinc finger
PfamPF006436.4E-62051IPR000315B-box-type zinc finger
CDDcd000217.90E-72259No hitNo description
PROSITE profilePS5011910.26757104IPR000315B-box-type zinc finger
SMARTSM003366.4E-1357104IPR000315B-box-type zinc finger
CDDcd000212.96E-1060104No hitNo description
PfamPF062039.4E-18293335IPR010402CCT domain
PROSITE profilePS5101716.817293335IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MDLAGKMAEL AAGRKFPMRA KPCDTCKINA AVLFCRTDST YMCMDCDSRI HGNNSYERVW  60
MCEVCEHAPS SVTCKADAAA LCVMCDWDIH SANPLARRHE RVPVTPFYHA AVGVVKSTAT  120
AILEIPPIES ESNMIGYKNC NKNLCHGHEE TKLSADVQAD MKSIEFLFSD PDNLLEFGYP  180
APNDVVPLYG HHSTGADSVV PVQISTKPAP QSSSVMGSVD NPFEIDFTTS NISSFNNSFA  240
APSVSQNISS DVGIVPDGSM SDTSYPFVLQ MKNNVNTNTP YNGTAQASVE MDRKARVMRY  300
REKRKNRKFE KTIRYASRKA YAETRPRIKG RFAKRTENTE DVDRWFTSVP ATTNFINNSG  360
FGVVPSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017237885.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5-like
TrEMBLA0A161WR650.0A0A161WR65_DAUCS; Uncharacterized protein
STRINGVIT_11s0052g01800.t011e-105(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.12e-87CONSTANS-like 5