PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_009857
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family bZIP
Protein Properties Length: 251aa    MW: 28747.7 Da    PI: 7.0229
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_009857genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.15.2e-1083131250
                  XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                  + +k+ rr ++NR AA rsR+RKk +++eLe k+k +e+e k+L   l+
  DCAR_009857  83 PNSKKKRRQERNRDAAFRSRERKKLYVKELEMKSKYFEEECKRLGMMLN 131
                  5789************************************999976665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.1E-1276144No hitNo description
SMARTSM003380.002380146IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.26684147IPR004827Basic-leucine zipper domain
PfamPF001702.0E-885140IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.44E-1086142No hitNo description
CDDcd147044.18E-1287138No hitNo description
PROSITE patternPS00036089104IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MSDHGGEENE EKNEEDDDDR IKNLELEQLL ALPNDEEWDL SDSEFFNFFQ GWQNVPSPSL  60
LAAAPLDNQP IIHHQNNPTQ DDPNSKKKRR QERNRDAAFR SRERKKLYVK ELEMKSKYFE  120
EECKRLGMML NCVAAENHAL RLSLQTRTAS DVSRTKQESA VLFLESLLLG SLLWFLGVMC  180
LVNLPEHLLP KKEVPLGNMD NQNQGILAPR KTGSNILKLQ CFPSSVRGKR CKASRTRMKL  240
SFSFAQQALM *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18589KKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017242610.10.0PREDICTED: bZIP transcription factor 60-like
TrEMBLA0A162AHE20.0A0A162AHE2_DAUCS; Uncharacterized protein
STRINGXP_009608063.18e-46(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA71012128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.12e-15basic region/leucine zipper motif 60