PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_009840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 436aa    MW: 47336.9 Da    PI: 5.5444
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_009840genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3696.2e-113714313374
         GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                   lLl+cAe+v+ ++le a+ lL ++sel+sp+g++ +R+aayf+eAL+ar+ +s+ ++y+ l+ ++ + ++ ++  ++l+ ++ +sP++kfsh+taNq
  DCAR_009840  71 GLLLQCAECVAVDNLEDASDLLPEISELSSPYGSSPERVAAYFAEALQARIISSCLGTYSPLNIKNLTLTQCQKICNSLQSYNSISPLIKFSHFTANQ 168
                  58************************************************************************************************ PP

         GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                  aI +a+ege++vHiiD+di+qGlQWp L++ LasR+++  s++iTgvgs    s e le+tg+rLa+fA++l +pfef +l  k  +  +l +L v+ 
  DCAR_009840 169 AIFQALEGEDHVHIIDLDIMQGLQWPGLFHILASRTRKIRSIKITGVGS----SIELLEATGRRLADFASSLSLPFEFLPLEGKIGNITDLAQLGVRL 262
                  *************************************************....9**************************9888888889*******9 PP

         GRAS 199 .gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreiv 295
                   gEa++V++++  h l+d ++s       +L+l+  ++Pk+++++eq+++h ++sFl rf+eal+yysalfd++  +l++++ er++vE++l+g ei+
  DCAR_009840 263 aGEAIVVHWMH--HCLYDVTGSDLG----TLRLLSLVRPKLITIIEQDLSH-AGSFLGRFVEALHYYSALFDAVGDGLGEDNLERHTVEQQLFGCEIR 353
                  9*********9..888888888888....9*********************.899******************************************* PP

         GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  n+va  g +r+ + + +ekW e l++ GF++v+l  + a+qa+lll +++++gy++ ee+gsl lgWkd +L+++SaW+
  DCAR_009840 354 NIVAVGGPKRTGEVK-VEKWGEELRRIGFGTVSLAGNPAAQASLLLGMFPWKGYTLVEENGSLKLGWKDLSLLTASAWQ 431
                  *********998887.9*************************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.20143411IPR005202Transcription factor GRAS
PfamPF035142.1E-11071431IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048366Biological Processleaf development
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MLHSLVPHLP IATTSDPNST AMKSKRPHDL PSTADDDASA HKRLNYSAEA SLSGEKHDED  60
GAEYSGLRLL GLLLQCAECV AVDNLEDASD LLPEISELSS PYGSSPERVA AYFAEALQAR  120
IISSCLGTYS PLNIKNLTLT QCQKICNSLQ SYNSISPLIK FSHFTANQAI FQALEGEDHV  180
HIIDLDIMQG LQWPGLFHIL ASRTRKIRSI KITGVGSSIE LLEATGRRLA DFASSLSLPF  240
EFLPLEGKIG NITDLAQLGV RLAGEAIVVH WMHHCLYDVT GSDLGTLRLL SLVRPKLITI  300
IEQDLSHAGS FLGRFVEALH YYSALFDAVG DGLGEDNLER HTVEQQLFGC EIRNIVAVGG  360
PKRTGEVKVE KWGEELRRIG FGTVSLAGNP AAQASLLLGM FPWKGYTLVE ENGSLKLGWK  420
DLSLLTASAW QPPAG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A1e-166554329379Protein SCARECROW
5b3h_D1e-166554329379Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017237117.10.0PREDICTED: scarecrow-like protein 23
SwissprotQ9FHZ10.0SCL23_ARATH; Scarecrow-like protein 23
TrEMBLA0A166ADF20.0A0A166ADF2_DAUCS; Uncharacterized protein
STRINGEOX931730.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA107452126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41920.11e-175GRAS family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yoon EK, et al.
    Conservation and Diversification of the SHR-SCR-SCL23 Regulatory Network in the Development of the Functional Endodermis in Arabidopsis Shoots.
    Mol Plant, 2016. 9(8): p. 1197-1209
    [PMID:27353361]