PlantRegMap
Plant Transcription Factor Database
PlantTFDB
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_009698
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 441aa    MW: 48955.5 Da    PI: 4.963
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_009698genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS301.22.5e-92454312373
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                  ++lLl+cA a++++d +laq++++ l++ as +gdp+qRl++ f++AL +r +r ++++++   +s+ +++ ++ +   l  ++++ P+++f++ ++N
  DCAR_009698  45 EKLLLHCASALEQNDVTLAQQVMWVLNNVASASGDPNQRLTSWFLRALVSRASRVCPTTMDFNGSSTIKRRLMTVT--ELAGYVDLIPWHRFGFCATN 140
                  689***************************************************9999998776666664333332..3335**************** PP

         GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfefnvl............ 181
                  +aI +a++g+ +vHiiDf+i++++QWp+L++aLa+RpegppslRi +v+s ++      + + ee+g+rLa+fA+  +vpfefnv+            
  DCAR_009698 141 SAIFKAIQGCPKVHIIDFSITHCMQWPTLIDALAKRPEGPPSLRISVVASWRPPvppfLNVSSEEVGQRLANFAKFGDVPFEFNVIedlsnfsndnts 238
                  **************************************************887788889999**************************9*99999877 PP

         GRAS 182 ...vak.rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                     + +  l++l++++L ++ +E+l++n++  l +l+d++   +s rd +L ++k+l+P++v+vv++++d+++ s+  r++ ++++ +  fd+le+ l
  DCAR_009698 239 snfHYDmLLSMLNPSALGLRDDETLVINCQNWLRYLPDDQKGNAS-RDVFLCMIKRLNPRIVTVVDEDSDLGALSLTSRITTCFNFLWIPFDALETFL 335
                  776333367788999**********************99999998.**************************************************** PP

         GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                  +++s +r+  E+  +g +i+n++  eg +r+er e+  + ++r++++G+ ++p+se+++k++k +l +++  g+ +++e++ lvl+Wk+++ v ++aW
  DCAR_009698 336 SKDSTQRAEFEAD-IGHKIENIIGFEGGQRIERLESGIQLSQRMSNSGYLSIPFSEETVKEVKEVLDEHA-SGWGMKNEEDMLVLTWKGHNSVYATAW 431
                  *************.********************************************************.889999********************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.70318413IPR005202Transcription factor GRAS
PfamPF035148.5E-9045431IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MKAEIRGSTS SLPLQSSSHF NSSSQNSLAG ALHGCLGNLD GACIEKLLLH CASALEQNDV  60
TLAQQVMWVL NNVASASGDP NQRLTSWFLR ALVSRASRVC PTTMDFNGSS TIKRRLMTVT  120
ELAGYVDLIP WHRFGFCATN SAIFKAIQGC PKVHIIDFSI THCMQWPTLI DALAKRPEGP  180
PSLRISVVAS WRPPVPPFLN VSSEEVGQRL ANFAKFGDVP FEFNVIEDLS NFSNDNTSSN  240
FHYDMLLSML NPSALGLRDD ETLVINCQNW LRYLPDDQKG NASRDVFLCM IKRLNPRIVT  300
VVDEDSDLGA LSLTSRITTC FNFLWIPFDA LETFLSKDST QRAEFEADIG HKIENIIGFE  360
GGQRIERLES GIQLSQRMSN SGYLSIPFSE ETVKEVKEVL DEHASGWGMK NEEDMLVLTW  420
KGHNSVYATA WVPSCGFDEE *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_B3e-58134342421Protein SHORT-ROOT
5b3h_E3e-58134342421Protein SHORT-ROOT
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017240892.10.0PREDICTED: scarecrow-like protein 32
TrEMBLA0A166AAE50.0A0A166AAE5_DAUCS; Uncharacterized protein
STRINGVIT_12s0059g02770.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA103032227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-118GRAS family protein