PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_009383
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 585aa    MW: 63961.5 Da    PI: 7.5232
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_009383genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS328.81.1e-1002175842374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                  ++ L+e+A a+s+ ++  a  +L+rl +l + +g++ qRl+ay+++AL +r+++          +++ ++  s++++ ++++++e+sP++k+++++aN
  DCAR_009383 217 KQSLIEAASAISDAKNDVALDTLTRLIKLGNTKGTSEQRLVAYLAQALMSRVQS----------TQSPTDLYSKDHMLSTQMLYEMSPCFKLGFMAAN 304
                  689**************************************************9..........233333349999********************** PP

         GRAS 100 qaIleavege...ervHiiDfdisqGlQWpaLlqaLasRp...egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                   aIle++ ++    ++H++Dfdi+qG Q++ Ll++La++    ++  sl+iT++++ +s+ + +l  ++++L+ +A++ gv+f fn+ ++++  +l+ 
  DCAR_009383 305 LAILEEIGSDanaVKLHVVDFDIGQGRQYVHLLHTLAAKIkneNKLISLKITALVD-HSDLSSQLTIVRDNLNAVASRAGVNFTFNA-MSSNAIKLTS 400
                  *******988744566*********************99854444559********.6678999***********************.79999999** PP

         GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErel 289
                  +++ v+++++l+Vnl+++l++l+desv++++ rd +L+ vk lsPkvv+vveq++++n++sFl r+ e l+yy alfdsl+a+l+r++ +r+ +E+  
  DCAR_009383 401 DAIGVQSDDVLVVNLAFKLFKLPDESVTTDNLRDGLLHSVKALSPKVVTVVEQDMNCNTASFLPRVNEVLKYYGALFDSLDATLSRDNVDRMRIEEG- 497
                  *************************************************************************************************. PP

         GRAS 290 lgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk..sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  l+r+ +n vaceg++r+er+e ++kWr+r+++aGF++ ++s+k  ++ +  ++     + g++v+ee g + +gW++r+L+++SaWr
  DCAR_009383 498 LSRKMCNSVACEGRDRVERCEVFGKWRARMGMAGFEAKKMSQKLIDSLRVKVNSGTrgNPGFTVNEEAGGVGFGWMGRSLTVASAWR 584
                  ***********************************************99999876556899*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.136190562IPR005202Transcription factor GRAS
PfamPF035143.6E-98217584IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 585 aa     Download sequence    Send to blast
MSSGRYPDFY NSGGLNGRSV MNINNSQGPY RPYLAGITPD QASLLQRRSD LIGKRSLADF  60
QQQFQHQQQQ QLGVYLRDVK QRVNYQQHAS PISTLSPPVD FSGNSLSPEL SAISSSSIYG  120
LPVLQQLRRP AGVPIISDVV VKTEENKMMS RLQELENELL TDEEDQNGVV SILSNSEWSE  180
TIQNLIGSGH KPYISPSPTS SASSCSSSSI SPPVCAKQSL IEAASAISDA KNDVALDTLT  240
RLIKLGNTKG TSEQRLVAYL AQALMSRVQS TQSPTDLYSK DHMLSTQMLY EMSPCFKLGF  300
MAANLAILEE IGSDANAVKL HVVDFDIGQG RQYVHLLHTL AAKIKNENKL ISLKITALVD  360
HSDLSSQLTI VRDNLNAVAS RAGVNFTFNA MSSNAIKLTS DAIGVQSDDV LVVNLAFKLF  420
KLPDESVTTD NLRDGLLHSV KALSPKVVTV VEQDMNCNTA SFLPRVNEVL KYYGALFDSL  480
DATLSRDNVD RMRIEEGLSR KMCNSVACEG RDRVERCEVF GKWRARMGMA GFEAKKMSQK  540
LIDSLRVKVN SGTRGNPGFT VNEEAGGVGF GWMGRSLTVA SAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-3420458410375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017243150.10.0PREDICTED: scarecrow-like protein 8
TrEMBLA0A166A1C40.0A0A166A1C4_DAUCS; Uncharacterized protein
STRINGVIT_16s0050g00950.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA40232443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.11e-125SCARECROW-like 8