PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_009224
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 451aa    MW: 50426.5 Da    PI: 5.931
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_009224genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS396.72.5e-121924451374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdg..dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                  lv++L++cA+ v+ g l+ a+alL++l+ l s       + ++aayf  AL++r+++        l+ s     +  e+   ++ f+e++P+lkf+h+
  DCAR_009224  92 LVHVLMSCADSVQRGTLSVASALLEELQVLLSRVNseFGFGKVAAYFIDALSRRVFK-------PLERSLG---SAFENEVLYHHFYEACPYLKFAHF 179
                  689**************************96655522599****************9.......3333333...35556677889************* PP

         GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                  t NqaIlea++g+ +vH+iDf+++qGlQWpaL+qaLa Rp+gpp+lRiTg+g+ + + ++ l+etg rLa++A++++v+f f+ ++a++++d++l++L
  DCAR_009224 180 TSNQAILEAFDGQACVHVIDFNLMQGLQWPALIQALALRPNGPPTLRITGIGPVSLDGHDPLRETGLRLAQLARSVNVRFAFRGVAASNIDDVKLWML 277
                  *****************************************************9999***************************************** PP

         GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                  +v+p+Ea+aVn+++qlh+lld++  ++s    vLkl+ sl Pk+v++veq+++hn+++F ++f eal+yys++fdslea     +  ++++ + +++r
  DCAR_009224 278 QVDPKEAVAVNCIMQLHKLLDDPSRIDS----VLKLIHSLDPKIVTLVEQDTNHNQPDFSDKFREALDYYSTMFDSLEAC----KGPQKWLAEIYIQR 367
                  ********************88777777....*********************************************999....788999999***** PP

         GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  ei++vv+c++      he l++Wrer+++ GF++v l+ +a+kqa++ll  ++ + gyrv+e++g+l lgW++rpL+++SaWr
  DCAR_009224 368 EICSVVCCAEM-----HEPLAQWRERMSRNGFTSVCLGANAYKQANMLLTVFSaQGGYRVDESEGCLKLGWHNRPLIAASAWR 445
                  ********987.....5************************************8888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120418.6E-73061IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098558.02766424IPR005202Transcription factor GRAS
PfamPF035148.6E-11992445IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MSFKSNCSSS LPPLLAAANY TTIPSPLSEL TQLHNENTLL NNPSELSSWV DSLLTEFNQP  60
TSINNITAWN DYNTTSYCNI RQIIEEDSSI RLVHVLMSCA DSVQRGTLSV ASALLEELQV  120
LLSRVNSEFG FGKVAAYFID ALSRRVFKPL ERSLGSAFEN EVLYHHFYEA CPYLKFAHFT  180
SNQAILEAFD GQACVHVIDF NLMQGLQWPA LIQALALRPN GPPTLRITGI GPVSLDGHDP  240
LRETGLRLAQ LARSVNVRFA FRGVAASNID DVKLWMLQVD PKEAVAVNCI MQLHKLLDDP  300
SRIDSVLKLI HSLDPKIVTL VEQDTNHNQP DFSDKFREAL DYYSTMFDSL EACKGPQKWL  360
AEIYIQREIC SVVCCAEMHE PLAQWRERMS RNGFTSVCLG ANAYKQANML LTVFSAQGGY  420
RVDESEGCLK LGWHNRPLIA ASAWRPNPRL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-599944626380Protein SCARECROW
5b3h_A2e-599944625379Protein SCARECROW
5b3h_D2e-599944625379Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Transcription coactivator of the zinc finger transcription factors GAF1/IDD2 and ENY/IDD1 in regulation of gibberellin homeostasis and signaling (PubMed:25035403). No effect of the BOI proteins on its stability. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Positively regulates XERICO expression. In contrast to RGA, it is less sensitive to GA. Its activity is probably regulated by other phytohormones such as auxin and ethylene. {ECO:0000269|PubMed:11487693, ECO:0000269|PubMed:11606551, ECO:0000269|PubMed:11606552, ECO:0000269|PubMed:14973286, ECO:0000269|PubMed:15128937, ECO:0000269|PubMed:16034591, ECO:0000269|PubMed:17933900, ECO:0000269|PubMed:25035403, ECO:0000269|PubMed:9389651}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017238853.10.0PREDICTED: DELLA protein GAI-like
SwissprotQ9LQT81e-135GAI_ARATH; DELLA protein GAI
TrEMBLA0A165ZV690.0A0A165ZV69_DAUCS; Uncharacterized protein
STRINGAquca_001_00705.10.0(Aquilegia coerulea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1514158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-137GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Gallego-Giraldo C, et al.
    Role of the gibberellin receptors GID1 during fruit-set in Arabidopsis.
    Plant J., 2014. 79(6): p. 1020-1032
    [PMID:24961590]
  4. Fukazawa J, et al.
    DELLAs function as coactivators of GAI-ASSOCIATED FACTOR1 in regulation of gibberellin homeostasis and signaling in Arabidopsis.
    Plant Cell, 2014. 26(7): p. 2920-38
    [PMID:25035403]
  5. MarĂ­n-de la Rosa N, et al.
    Genome Wide Binding Site Analysis Reveals Transcriptional Coactivation of Cytokinin-Responsive Genes by DELLA Proteins.
    PLoS Genet., 2015. 11(7): p. e1005337
    [PMID:26134422]
  6. Shi H,Wei Y,Wang Q,Reiter RJ,He C
    Melatonin mediates the stabilization of DELLA proteins to repress the floral transition in Arabidopsis.
    J. Pineal Res., 2016. 60(3): p. 373-9
    [PMID:26887824]
  7. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  8. Qu J,Kang SG,Hah C,Jang JC
    Molecular and cellular characterization of GA-Stimulated Transcripts GASA4 and GASA6 in Arabidopsis thaliana.
    Plant Sci., 2016. 246: p. 1-10
    [PMID:26993231]
  9. Shahnejat-Bushehri S,Nobmann B,Devi Allu A,Balazadeh S
    JUB1 suppresses Pseudomonas syringae-induced defense responses through accumulation of DELLA proteins.
    Plant Signal Behav, 2016. 11(6): p. e1181245
    [PMID:27159137]
  10. Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S
    Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling.
    Nat Plants, 2016. 2: p. 16013
    [PMID:27249348]
  11. Wang H, et al.
    The DELLA-CONSTANS Transcription Factor Cascade Integrates Gibberellic Acid and Photoperiod Signaling to Regulate Flowering.
    Plant Physiol., 2016. 172(1): p. 479-88
    [PMID:27406167]
  12. Li W,Wang H,Yu D
    Arabidopsis WRKY Transcription Factors WRKY12 and WRKY13 Oppositely Regulate Flowering under Short-Day Conditions.
    Mol Plant, 2016. 9(11): p. 1492-1503
    [PMID:27592586]
  13. Liu B,De Storme N,Geelen D
    Gibberellin Induces Diploid Pollen Formation by Interfering with Meiotic Cytokinesis.
    Plant Physiol., 2017. 173(1): p. 338-353
    [PMID:27621423]
  14. Matsuoka K, et al.
    Differential Cellular Control by Cotyledon-Derived Phytohormones Involved in Graft Reunion of Arabidopsis Hypocotyls.
    Plant Cell Physiol., 2016. 57(12): p. 2620-2631
    [PMID:27986917]
  15. Zentella R, et al.
    The Arabidopsis O-fucosyltransferase SPINDLY activates nuclear growth repressor DELLA.
    Nat. Chem. Biol., 2017. 13(5): p. 479-485
    [PMID:28244988]
  16. Zhang Y, et al.
    GA-DELLA pathway is involved in regulation of nitrogen deficiency-induced anthocyanin accumulation.
    Plant Cell Rep., 2017. 36(4): p. 557-569
    [PMID:28275852]
  17. Zhang L,Chen L,Yu D
    Transcription Factor WRKY75 Interacts with DELLA Proteins to Affect Flowering.
    Plant Physiol., 2018. 176(1): p. 790-803
    [PMID:29133369]
  18. Nelson SK,Ariizumi T,Steber CM
    Biology in the Dry Seed: Transcriptome Changes Associated with Dry Seed Dormancy and Dormancy Loss in the Arabidopsis GA-Insensitive sleepy1-2 Mutant.
    Front Plant Sci, 2017. 8: p. 2158
    [PMID:29312402]
  19. Liu B,De Storme N,Geelen D
    Cold-Induced Male Meiotic Restitution in Arabidopsis thaliana Is Not Mediated by GA-DELLA Signaling.
    Front Plant Sci, 2018. 9: p. 91
    [PMID:29459879]
  20. Zhang Y, et al.
    DELLA proteins negatively regulate dark-induced senescence and chlorophyll degradation in Arabidopsis through interaction with the transcription factor WRKY6.
    Plant Cell Rep., 2018. 37(7): p. 981-992
    [PMID:29574486]
  21. Felipo-Benavent A, et al.
    Regulation of xylem fiber differentiation by gibberellins through DELLA-KNAT1 interaction.
    Development, 2019.
    [PMID:30389856]
  22. Wright DA, et al.
    Recovery of YAC-end sequences through complementation of an Escherichia coli pyrF mutation.
    Nucleic Acids Res., 1997. 25(13): p. 2679-80
    [PMID:9185581]