PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_009102
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 587aa    MW: 64853.8 Da    PI: 8.1036
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_009102genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601376.6e-4371061100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv kll++lp  +reda++sl+yeA+ar+rdP+yG+vg+i+ lq++l+q++ el  +k
  DCAR_009102   7 PCAACKLLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKLLNDLPAVQREDAVNSLAYEADARLRDPIYGCVGLISILQHKLKQVQMELYNAK 104
                  7*********************************************************************************************9988 PP

       DUF260  99 ee 100
                  +e
  DCAR_009102 105 KE 106
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.9366107IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-427104IPR004883Lateral organ boundaries, LOB
SuperFamilySSF1034731.96E-20239315IPR020846Major facilitator superfamily domain
Gene3DG3DSA:1.20.1250.201.0E-4240311No hitNo description
SuperFamilySSF1034731.96E-20363574IPR020846Major facilitator superfamily domain
Gene3DG3DSA:1.20.1250.202.1E-5377544No hitNo description
CDDcd061740.00101421541IPR020846Major facilitator superfamily domain
Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    Send to blast
MSSSNSPCAA CKLLRRKCTQ ECVFAPYFPP DQPQKFANVH KVFGASNVAK LLNDLPAVQR  60
EDAVNSLAYE ADARLRDPIY GCVGLISILQ HKLKQVQMEL YNAKKELSTY IGPSAMLPIL  120
PAPGNFIPPY QHQQPSQMMP YNMQAAQMMG GSPQNVVNPN PLVIQQQQNY QQIMEAQQVA  180
AVVAAAREQE MLRSYEQQQA VLTQQQGRHS DQLTTSVVCK PSVQRKKEKE GEIFTSERIS  240
TSWGVGLVIG PAIGGYFAQP AENYPNIFSE KSIFGRFPYF LPCLLISLFA FLVSIISFWL  300
PETLHIHHGN KNEQCDAADA LENSMYKYRV DGVSRHGNKN EQCDAADASE NSMYKSRVDG  360
VIRSKERLPS SKLSLLRNWP LMSAITVYCV FQLHDTAYAE AFTLWADSPR KYGGLHYKIP  420
EVGEVLAISG FGLLILQMFL YPVLERTFGA ILVSRIGAVA TIPLLTCYPY IAKLSGNLLF  480
AVLSCASILM NVLMVSVSTG LYLLQNRAVS SDQRGAANGI SMSALSLFKA FGPACGGSFF  540
SWAQTRQNPT FLPGDQIVFS ILNSIEFIGL AMTFKPFLVL PNDDSQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-4641228131LOB family transfactor Ramosa2.1
5ly0_B9e-4641228131LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMajor facilitator superfamily (MFS) transporter probably involved in 2,4-dichlorophenoxyacetic acid (2,4-D) export (PubMed:19440702). K(+) may be the physiological substrate of the transporter (PubMed:23524662). {ECO:0000269|PubMed:19440702, ECO:0000269|PubMed:23524662}.; FUNCTION: Isoform 1: Modulates root auxin-related processes. Involved in auxin efflux and acts as a positive regulator of shootward transport at the root apex. May mediate proton efflux from the vacuolar compartment. {ECO:0000269|PubMed:23524662}.; FUNCTION: Isoform 3: Mediates drought stress tolerance by regulating stomatal closure. {ECO:0000269|PubMed:23524662}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By 2,4-D treatment. {ECO:0000269|PubMed:19440702}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017238844.10.0PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform X2
SwissprotQ94BZ11e-112ZIFL1_ARATH; Protein ZINC INDUCED FACILITATOR-LIKE 1
TrEMBLA0A165ZRX10.0A0A165ZRX1_DAUCS; Uncharacterized protein
STRINGEOY086711e-134(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.18e-68ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Muños S, et al.
    Transcript profiling in the chl1-5 mutant of Arabidopsis reveals a role of the nitrate transporter NRT1.1 in the regulation of another nitrate transporter, NRT2.1.
    Plant Cell, 2004. 16(9): p. 2433-47
    [PMID:15319483]
  2. Haydon MJ,Cobbett CS
    A novel major facilitator superfamily protein at the tonoplast influences zinc tolerance and accumulation in Arabidopsis.
    Plant Physiol., 2007. 143(4): p. 1705-19
    [PMID:17277087]
  3. Waters BM,Grusak MA
    Quantitative trait locus mapping for seed mineral concentrations in two Arabidopsis thaliana recombinant inbred populations.
    New Phytol., 2008. 179(4): p. 1033-47
    [PMID:18631293]
  4. Cabrito TR,Teixeira MC,Duarte AA,Duque P,Sá-Correia I
    Heterologous expression of a Tpo1 homolog from Arabidopsis thaliana confers resistance to the herbicide 2,4-D and other chemical stresses in yeast.
    Appl. Microbiol. Biotechnol., 2009. 84(5): p. 927-36
    [PMID:19440702]
  5. Remy E, et al.
    A major facilitator superfamily transporter plays a dual role in polar auxin transport and drought stress tolerance in Arabidopsis.
    Plant Cell, 2013. 25(3): p. 901-26
    [PMID:23524662]