PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_008970
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRF
Protein Properties Length: 395aa    MW: 43822.7 Da    PI: 5.0396
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_008970genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC72.93.6e-2369113145
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                  daep+rC+RtDGKkWRCsr+v + +k+CErH+hrg+ rsrk++e+
  DCAR_008970  69 DAEPWRCKRTDGKKWRCSRDVAPCQKYCERHMHRGKPRSRKPVEQ 113
                  79****************************************997 PP

2QLQ53.19.8e-191848232
          QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLl 32
                 aFT aQ+ +L++Q+++yKy++a++PvPp+Ll
  DCAR_008970 18 AFTRAQWKELERQAMIYKYIVASVPVPPHLL 48
                 8*****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.9E-91753IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.9E-131848IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.3681853IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.77369113IPR014977WRC domain
PfamPF088792.0E-1870112IPR014977WRC domain
PROSITE patternPS010540200208IPR018225Transaldolase, active site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005975Biological Processcarbohydrate metabolic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MATTALGYPG CSGAEAAAFT RAQWKELERQ AMIYKYIVAS VPVPPHLLSS DATSWSSLVY  60
NLKYGNNKDA EPWRCKRTDG KKWRCSRDVA PCQKYCERHM HRGKPRSRKP VEQQQQQQQQ  120
VSSTGNKKTR QHLPANAPAS PKAPAAPQET SIHNNPSMNL LKNVAETEDV SLRDSDWMIE  180
SRMMTMETSE QQWHQLMSEG STTNPSIFQH SNYEKEQELS LLSIPEIENS STDEYTMFLS  240
PYYNPRDFID VWSNDSNPEY YSKNKSSGAA DANVSPSSLD FSMTMAVRDT FDNEMGQIEM  300
EENRDAYERC RDLNLLSPIS WMGSDSGGPL AEVLRPTNAA DGDVISPLAT SASSPTGVLQ  360
RTMLSLSDSS VCNSPTGVAT SAAAAEIVGF QWLN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017237826.10.0PREDICTED: growth-regulating factor 5-like
RefseqXP_017237827.10.0PREDICTED: growth-regulating factor 5-like
RefseqXP_017237828.10.0PREDICTED: growth-regulating factor 5-like
TrEMBLA0A165ZMP60.0A0A165ZMP6_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70322230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.11e-32growth-regulating factor 2