PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_008485
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 465aa    MW: 52119.7 Da    PI: 7.0224
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_008485genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS321.41.8e-981064633374
         GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                  ++L+++ e + sg ++ aqa+Larl+++ s + +p+qR+a+yf+eAL+  l+   s+ ++ +p+++ ++ +   ++ a+k++sevsP+++f ++t Nq
  DCAR_008485 106 DQLYKATELILSGTFSHAQAILARLNHQLSLNIKPFQRAAFYFKEALQMSLLM-ISNPVSPIPSRTPTPVDGMFKIGAYKVLSEVSPLIQFMNFTSNQ 202
                  689*************************************************7.777777999999999***************************** PP

         GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                  a+leav +++ +HiiDfdi+ G+QW ++lq+L  R++gppsl+iT+++sp++++  el  ++e+L++fA+++gv+fe +v+   +++++++++ +v++
  DCAR_008485 203 ALLEAVGNADSIHIIDFDIGFGAQWSSFLQELPRRDSGPPSLKITAFASPTTHHPIELGLMHENLTQFATKIGVSFELEVV---NFDSFDPNSYSVSS 297
                  ********************************************************************************8...9***********99 PP

         GRAS 199 .gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreiv 295
                   +Ea+aVn+ +   + +     l+   +++++++k+lsPk++v +++ +++ + +  +++l++++yy  lfdsl+a    ++++ +k+E++l++++i+
  DCAR_008485 298 dNEAVAVNFPIWSSSSH-----LPA-LPSLVSFIKQLSPKIMVSMDRGCERIDLPCPQHLLHTFQYYEILFDSLDAA-NVTTDTVTKIEKFLFQPKIE 388
                  9********99555544.....333.567*********************************************666.468999************** PP

         GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  ++v  +        e+   W++ + ++GF+pv++s++a++qa++l+++++++g++ve++++slvl+W++r+L+s+SaWr
  DCAR_008485 389 SMVLGRLHF----PEHTLPWKSLFASMGFSPVAFSNFAETQAEYLVKRTQVRGFHVEKRQASLVLCWQHRELMSASAWR 463
                  ***987776....88889************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.59978443IPR005202Transcription factor GRAS
PfamPF035146.2E-96106463IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MSSTLLLANS NFSQKEQHQF EPQLKRHNLG LTSCSTGVTK IPFVDEVLST KQQTQIGFAN  60
QLNLLPTHQL LQKPFVPPNQ DLTGGVREQI SAASHLHQQQ QQVIYDQLYK ATELILSGTF  120
SHAQAILARL NHQLSLNIKP FQRAAFYFKE ALQMSLLMIS NPVSPIPSRT PTPVDGMFKI  180
GAYKVLSEVS PLIQFMNFTS NQALLEAVGN ADSIHIIDFD IGFGAQWSSF LQELPRRDSG  240
PPSLKITAFA SPTTHHPIEL GLMHENLTQF ATKIGVSFEL EVVNFDSFDP NSYSVSSDNE  300
AVAVNFPIWS SSSHLPALPS LVSFIKQLSP KIMVSMDRGC ERIDLPCPQH LLHTFQYYEI  360
LFDSLDAANV TTDTVTKIEK FLFQPKIESM VLGRLHFPEH TLPWKSLFAS MGFSPVAFSN  420
FAETQAEYLV KRTQVRGFHV EKRQASLVLC WQHRELMSAS AWRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-3312346322375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017236616.10.0PREDICTED: scarecrow-like protein 6 isoform X1
SwissprotO813161e-114SCL6_ARATH; Scarecrow-like protein 6
TrEMBLA0A166FDD60.0A0A166FDD6_DAUCS; Uncharacterized protein
STRINGVIT_02s0154g00400.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA69861931
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-110GRAS family protein
Publications ? help Back to Top
  1. Bari A,Orazova S,Ivashchenko A
    miR156- and miR171-binding sites in the protein-coding sequences of several plant genes.
    Biomed Res Int, 2013. 2013: p. 307145
    [PMID:23936788]
  2. Xue XY, et al.
    Interaction between two timing microRNAs controls trichome distribution in Arabidopsis.
    PLoS Genet., 2014. 10(4): p. e1004266
    [PMID:24699192]