PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_008421
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 671aa    MW: 75168.3 Da    PI: 5.8946
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_008421genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS419.92.2e-1282866541373
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  lv+lL++c +a++ ++ e +++++a+l elasp+g+++ Rl+ayfteA+a r+ar +++++ + +p+e + + ++e+ +al+l+++vsPi++f h+ta
  DCAR_008421 286 LVSLLMACIDAIHLKNIEGVNHFIAKLGELASPRGSSISRLTAYFTEAMALRVARVWPHIFYINTPRELN-SAEEESGTALRLLNQVSPIPQFIHFTA 382
                  689**********************************************************999999998.6788889999***************** PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  N+ +l+ +eg++rvHiiDfdi+qGlQWp+++q+La R+++p ++RiTg+g+    sk+ l etgerLa fA++l+++fef++ v++rled++l++L+v
  DCAR_008421 383 NEVLLRGFEGKDRVHIIDFDIKQGLQWPSFFQSLAFRNNPPSHVRITGIGE----SKQDLIETGERLAGFARALNLQFEFHP-VVDRLEDVRLWMLHV 475
                  ***************************************************....9**************************.7************** PP

         GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgrei 294
                  k+gE++aVn+++qlh++l + +s      ++L l++s++P++vv++eqeadhn +s+ +r+ ++l+yy a+fdsl+ +lp++s +rik+E++ +grei
  DCAR_008421 476 KEGECVAVNCIFQLHKMLYD-GSGGI-LMDFLGLLRSTNPTIVVMAEQEADHNYQSLETRLYNSLKYYGAIFDSLDLGLPQDSLARIKIEEM-FGREI 570
                  *****************954.44444.579**************************************************************.***** PP

         GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee.....sgslvlgWkdrpLvsvSaW 373
                  +n+++ceg++r erhe+++kW++ +e+ GF+++ ++e++  q ++ll+++++d yrve++     s +l+l W+d++L++vSaW
  DCAR_008421 571 KNIISCEGRDRLERHENFGKWSHLMESGGFRNIGITEREFLQSRMLLKMYSFDNYRVEKQglddgSSALTLSWSDQSLYTVSAW 654
                  ***************************************************999****887877788889************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.893260630IPR005202Transcription factor GRAS
PfamPF035147.6E-126286654IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 671 aa     Download sequence    Send to blast
MLAGCPSTLL SPRHRLRSEA SAQFQACHFP SMSTQRLELP CSFTRKETSR SQSIRPVVNL  60
SIEKPAEART SSCSLKKSIS LPPLTTAGQV VFHDGRLERR DEFRDKNKNR LKRFADENFF  120
DEDINRAKKI RGSRKYDDSS EGGENLCLDQ HWFHQSFEVP TSVSQFSGLN PQQAPFSLVY  180
SEEEDTCVAS SKVTISPLPN NPWAESVVTE FPKLGERDVE PSQAIAKEAS ESSTSSGSDN  240
NLANRVHDDA TEHEIGNVSR PHNPNGSTGF VAGSSDGNGD HDGFELVSLL MACIDAIHLK  300
NIEGVNHFIA KLGELASPRG SSISRLTAYF TEAMALRVAR VWPHIFYINT PRELNSAEEE  360
SGTALRLLNQ VSPIPQFIHF TANEVLLRGF EGKDRVHIID FDIKQGLQWP SFFQSLAFRN  420
NPPSHVRITG IGESKQDLIE TGERLAGFAR ALNLQFEFHP VVDRLEDVRL WMLHVKEGEC  480
VAVNCIFQLH KMLYDGSGGI LMDFLGLLRS TNPTIVVMAE QEADHNYQSL ETRLYNSLKY  540
YGAIFDSLDL GLPQDSLARI KIEEMFGREI KNIISCEGRD RLERHENFGK WSHLMESGGF  600
RNIGITEREF LQSRMLLKMY SFDNYRVEKQ GLDDGSSALT LSWSDQSLYT VSAWAPLDIA  660
GSSTSYSQPS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A7e-6528065613380Protein SCARECROW
5b3h_A7e-6528065612379Protein SCARECROW
5b3h_D7e-6528065612379Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017235778.10.0PREDICTED: scarecrow-like protein 28
SwissprotQ9CAN30.0SCL28_ARATH; Scarecrow-like protein 28
TrEMBLA0A166FBC70.0A0A166FBC7_DAUCS; Uncharacterized protein
STRINGSolyc08g080400.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55682434
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.10.0GRAS family protein