PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_008419
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 646aa    MW: 72495.6 Da    PI: 5.8678
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_008419genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS414.41e-1262606291373
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  lv+lL++c +a++ ++ e +++++a+l elasp+g+++ Rl+ayfteALa r+ar +++++ + +  e + + ++e+ +al+l++++sPi++f h+ta
  DCAR_008419 260 LVSLLIACINAIDLKNIEGVNHFIAKLGELASPRGSSLSRLTAYFTEALALRVARVWPHIFYINTLCELN-SAEEESGTALRLLNQISPIPQFIHFTA 356
                  689**********************************************************888777776.678899999****************** PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  N+ +l+ +eg++rvHiiDfdi+qGlQWp+++q+La R+++p ++RiTg+g+    sk+ l etgerLa fA++l+++fef++ v++rled++l++L+v
  DCAR_008419 357 NEVLLRGFEGKDRVHIIDFDIKQGLQWPSFFQSLAYRNNPPSHVRITGIGE----SKQDLIETGERLAGFARALNLQFEFHP-VVDRLEDVRLWMLHV 449
                  ***************************************************....9**************************.7************** PP

         GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgrei 294
                  k+gE++aVn+++qlh++l + +s      +++ l++s++P+vvv++eqeadhn +++  rf ++l+yy a+fdsl+  lp++s +rik+E++ ++rei
  DCAR_008419 450 KEGECVAVNCIFQLHKMLYD-GSGGI-LMDFMGLLRSTNPTVVVMAEQEADHNCHRLESRFYNSLKYYGAIFDSLDLCLPQDSLARIKIEEM-FAREI 544
                  *****************954.44444.579**************************************************************.***** PP

         GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee......sgslvlgWkdrpLvsvSaW 373
                  +n+++ceg++r erhe+++kWr+ +e+ GF+++ +++++  q ++ll+++++d +rve++        +l+l W+d+pL++vSaW
  DCAR_008419 545 KNIISCEGRDRLERHENFGKWRKLMETGGFRNIGITDREFLQSRMLLKMYSFDNFRVEKQqghldgCSALTLNWSDQPLYTVSAW 629
                  ***************************************************999****9855553233467************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.716234604IPR005202Transcription factor GRAS
PfamPF035143.5E-124260629IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 646 aa     Download sequence    Send to blast
MSTQRLELPC SFTRKETSRS QSIRPVVNLS IEKPAEARTS SCSLRKSISL PPLTSTGPVV  60
FHDSKLEKKD EFRDKSKNRL KRFVDENFFD KDDSCISRAK KIRGSRKYDD SLEGGEKLCL  120
DQLWFRQSFE VPTSVSQFSG LNPQQSPFSL LCSEEEETCF APSKVTATTS PLPNNPWANS  180
VVTEFPKLGE RNVEPSQAIA KEASESSTSS GSDNNLENRL HEDANEHEIG NGSSPNNPNG  240
STGFVAGSSD DNGDHDGFEL VSLLIACINA IDLKNIEGVN HFIAKLGELA SPRGSSLSRL  300
TAYFTEALAL RVARVWPHIF YINTLCELNS AEEESGTALR LLNQISPIPQ FIHFTANEVL  360
LRGFEGKDRV HIIDFDIKQG LQWPSFFQSL AYRNNPPSHV RITGIGESKQ DLIETGERLA  420
GFARALNLQF EFHPVVDRLE DVRLWMLHVK EGECVAVNCI FQLHKMLYDG SGGILMDFMG  480
LLRSTNPTVV VMAEQEADHN CHRLESRFYN SLKYYGAIFD SLDLCLPQDS LARIKIEEMF  540
AREIKNIISC EGRDRLERHE NFGKWRKLME TGGFRNIGIT DREFLQSRML LKMYSFDNFR  600
VEKQQGHLDG CSALTLNWSD QPLYTVSAWA PLDIAGSSAS HSQPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-6425463113380Protein SCARECROW
5b3h_A2e-6425463112379Protein SCARECROW
5b3h_D2e-6425463112379Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017231370.10.0PREDICTED: scarecrow-like protein 28
RefseqXP_017231371.10.0PREDICTED: scarecrow-like protein 28
RefseqXP_017231372.10.0PREDICTED: scarecrow-like protein 28
SwissprotQ9CAN30.0SCL28_ARATH; Scarecrow-like protein 28
TrEMBLA0A166FBB20.0A0A166FBB2_DAUCS; Uncharacterized protein
STRINGPGSC0003DMT4000078790.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55682434
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.10.0GRAS family protein