PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_007624
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 290aa    MW: 33287.4 Da    PI: 4.9712
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_007624genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.41.6e-40491481100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCaaCk++rrkCa+dC+lapyfp++++++f n+hklFG+sn++k+++ l++ ++++am++++y++++ra+dPv G++++i++lq+q+e  +ael+l+ 
  DCAR_007624  49 ACAACKYQRRKCAPDCILAPYFPHDRQQQFLNAHKLFGVSNITKIIRYLDQPDKDEAMRTIIYQSDVRANDPVGGCYRIIRELQRQIEYNRAELQLVL 146
                  7*********************************************************************************************9987 PP

       DUF260  99 ee 100
                  ++
  DCAR_007624 147 HQ 148
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.84948149IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-3749145IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MNTNTNVNKT HNNNNNFIYN NKSTPPSSTP TPAPAATNNN IIRSNGNQAC AACKYQRRKC  60
APDCILAPYF PHDRQQQFLN AHKLFGVSNI TKIIRYLDQP DKDEAMRTII YQSDVRANDP  120
VGGCYRIIRE LQRQIEYNRA ELQLVLHQLA YCRAQNQHNV NLLHSNNSGS FEHMMATNHN  180
DDVQQHYQER DDQVQQPDGQ DQQEYVLQNG DEDCDQVQFE EINSWEGTEN SLALEVKKDC  240
DAGAENSQED VHVKPDLDDN DKREELRYEV EEKSFDSVNK FRLKTTPAI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-26451427104LOB family transfactor Ramosa2.1
5ly0_B4e-26451427104LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017233648.10.0PREDICTED: LOB domain-containing protein 22
SwissprotQ9LRW12e-54LBD22_ARATH; LOB domain-containing protein 22
TrEMBLA0A166ENI70.0A0A166ENI7_DAUCS; Uncharacterized protein
STRINGcassava4.1_028597m9e-69(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA99262126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.18e-56LOB domain-containing protein 22
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]