PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_007539
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family bZIP
Protein Properties Length: 197aa    MW: 22939.3 Da    PI: 5.2765
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_007539genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.97.1e-1682140563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  +++rr+++NRe+ArrsR RK++ ++eL   v  L +eN++L+++l+  ++  +++ +e+
  DCAR_007539  82 RKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRSENHQLIDKLNDFSERHDQVLQEN 140
                  689*******************************************9999998888875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.1E-1578142IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.73780143IPR004827Basic-leucine zipper domain
PfamPF001702.8E-1282140IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.9E-1382155No hitNo description
SuperFamilySSF579592.39E-1382131No hitNo description
CDDcd147024.95E-2183134No hitNo description
PROSITE patternPS00036085100IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MQSTDVTDLH YLAPPNPTSY PAHFGYTQNN IPTFDYSRLS NPLYHLQINA QAQEFNPQTT  60
CFSSNSTSDE ADDQQISLIN ERKQRRMISN RESARRSRMR KQKHLDELWS QVVWLRSENH  120
QLIDKLNDFS ERHDQVLQEN AQLKEETSEL RQMLTDMQLN SPYHNLSNLE DIPCDTNYLK  180
SESPNLPISN SKDLLI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
194101RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00389DAPTransfer from AT3G30530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017232288.11e-143PREDICTED: basic leucine zipper 43
TrEMBLA0A166EKV41e-142A0A166EKV4_DAUCS; Uncharacterized protein
STRINGVIT_14s0083g00700.t014e-91(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9472492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.14e-55basic leucine-zipper 42