PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_007469
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 525aa    MW: 58361.6 Da    PI: 6.5085
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_007469genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS366.73.2e-1121525231374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaalklfsevsPilkfshl 96 
                  lv+lL++cAeav+ +d++ a+ lLa+l+ +a   g+++qR+a++f+++L  rla  ++     l++ + + ++  s+++  al+l +ev+P ++f+h+
  DCAR_007469 152 LVQLLISCAEAVACRDKSHASILLAELRANALVFGSSFQRVASCFVQGLTDRLALVQPLGTVGLTAATMNIMDiaSEKKEEALRLVYEVCPHIQFGHF 249
                  689***************************************************95555555556666666667788889999*************** PP

         GRAS  97 taNqaIleavegeervHiiDfdis....qGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl 189
                  +aN  Ilea+ege+ vH++D+++s    +G QW  L+++La+R+++pp  +RiTgvg       ++++ +g+ L+ +A +lg+++ef+v v+++le+l
  DCAR_007469 250 VANLSILEAFEGEKFVHVVDLGMSlglpHGQQWRHLINSLANRTGQPPhCVRITGVGL----CVDQYQIIGDELEAYAGSLGINLEFSV-VESSLENL 342
                  ********************99874444678*************887747********....**************************9.799***** PP

         GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEr 287
                  ++e+++++++E++a+n++lqlh +++es    +   +vL+++ +lsPkv+v+veq+++hn++ Fl rf+eal+yysa+fdsl+a lp+ +  r+k+E+
  DCAR_007469 343 RPEDIKLRKNEVVAINSILQLHCVVKESRGALN---AVLQIIHELSPKVLVLVEQDSSHNGPFFLGRFMEALHYYSAIFDSLDAMLPKYDTRRAKIEQ 437
                  *************************88887777...9************************************************************* PP

         GRAS 288 ellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  +++++ei+n+v+ceg +r erhe++ +Wr+r+++aGF+p+p++  a   ak  l k +  +gy++ ee+g+lvlgWk++p+v++S+W+
  DCAR_007469 438 FYFAEEIKNIVSCEGPARMERHERVDQWRRRMSRAGFQPAPIKMIAR--AKEWLGKREyCEGYTIVEEKGCLVLGWKSKPIVAASCWK 523
                  ******************************************87654..45555555559***************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.05126504IPR005202Transcription factor GRAS
PfamPF035141.1E-109152523IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MAYSFSAHPL YDNEQNVQLS GLDSRSSAMA DYPFVHLQNV NDVASTWIPT LSDETGSYKR  60
LKRTTSMGEF LESTYNSLYS KGSVGSRSSS MISRTISTSS LNSLPGLHIR DHIKTYTQRY  120
LAAEGVEEAT SEITGPENGE TREDGVADGM RLVQLLISCA EAVACRDKSH ASILLAELRA  180
NALVFGSSFQ RVASCFVQGL TDRLALVQPL GTVGLTAATM NIMDIASEKK EEALRLVYEV  240
CPHIQFGHFV ANLSILEAFE GEKFVHVVDL GMSLGLPHGQ QWRHLINSLA NRTGQPPHCV  300
RITGVGLCVD QYQIIGDELE AYAGSLGINL EFSVVESSLE NLRPEDIKLR KNEVVAINSI  360
LQLHCVVKES RGALNAVLQI IHELSPKVLV LVEQDSSHNG PFFLGRFMEA LHYYSAIFDS  420
LDAMLPKYDT RRAKIEQFYF AEEIKNIVSC EGPARMERHE RVDQWRRRMS RAGFQPAPIK  480
MIARAKEWLG KREYCEGYTI VEEKGCLVLG WKSKPIVAAS CWKC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A2e-641355221377Protein SCARECROW
5b3h_D2e-641355221377Protein SCARECROW
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017231414.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A166EJ480.0A0A166EJ48_DAUCS; Uncharacterized protein
STRINGXP_009359535.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA81672130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.16e-79RGA-like 1