PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_007311
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 547aa    MW: 60340.2 Da    PI: 4.8877
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_007311genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS444.85.8e-1361775431374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  lv+ L++cAeav++++++la+ l++++  la ++  +m+++a+yf+eALa+r++r        l p++++++  se  +    f+e++P+lkf+h+ta
  DCAR_007311 177 LVHSLMACAEAVQESNFKLAEVLVKQIGVLAVSQIGAMRKVATYFAEALARRIYR--------LYPQTQKDSGFSE--MLEMHFYETCPYLKFAHFTA 264
                  689****************************************************........5566665434444..44456*************** PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  NqaIlea++ +++vH+iDf+++qG+QWpaL+qaLa Rp+gpp++R+Tg+g+p++++++ l+e+g++La+fAe+++v+fe++ +va++l+dl+ ++L++
  DCAR_007311 265 NQAILEAFADKKMVHVIDFSMKQGMQWPALMQALALRPGGPPTFRLTGIGPPSQDNTDHLQEVGWKLAQFAETIQVKFEYRGFVANSLADLDASMLDL 362
                  ************************************************************************************************** PP

         GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak......lpreseerikvEre 288
                  ++gE++aVn++++lh+ll++++++e+    v+ +v +++P++v+v eqea+hn++ Fl+rf+e+l+yys+lfdsle+        ++ s ++++++++
  DCAR_007311 363 REGETVAVNSMFELHQLLARPGAIEK----VMAAVAQMKPEIVTVGEQEASHNGPLFLDRFTESLHYYSTLFDSLESCgggvdgGAAVSTQDKVMSEV 456
                  **************************....*********************************************88756665545556999****** PP

         GRAS 289 llgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  +lgr+i+n+vaceg +r+erhe l +Wr+r++ a F+pv+l+++a kqa++ll+ ++ +dgyrvee++g+l+lgW++rpL+++SaW+
  DCAR_007311 457 FLGRQICNLVACEGVDRIERHEPLTQWRDRFNLARFEPVHLGSNAFKQASMLLALFAgGDGYRVEEHEGCLMLGWHSRPLITTSAWK 543
                  **************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120412.7E-3137104IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011291.6E-2737110No hitNo description
PROSITE profilePS5098564.845151522IPR005202Transcription factor GRAS
PfamPF035142.0E-133177543IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MKRDHSAGAS SSMTGDIYSP GKSKMKWNDA EQDAGVDELL AVLGYKVKSS DMADIAEKLQ  60
HLETAMGQAQ QQEISQLGSD TVHYNPSDLN SWLNSMIGEF NPNQPDDMFA QSSSSKIIFD  120
DSDYDLKAIP GDAVLSNSNK RLKTEPSWEA PVSQSPSETQ NQAVQVLVDS QENGVRLVHS  180
LMACAEAVQE SNFKLAEVLV KQIGVLAVSQ IGAMRKVATY FAEALARRIY RLYPQTQKDS  240
GFSEMLEMHF YETCPYLKFA HFTANQAILE AFADKKMVHV IDFSMKQGMQ WPALMQALAL  300
RPGGPPTFRL TGIGPPSQDN TDHLQEVGWK LAQFAETIQV KFEYRGFVAN SLADLDASML  360
DLREGETVAV NSMFELHQLL ARPGAIEKVM AAVAQMKPEI VTVGEQEASH NGPLFLDRFT  420
ESLHYYSTLF DSLESCGGGV DGGAAVSTQD KVMSEVFLGR QICNLVACEG VDRIERHEPL  480
TQWRDRFNLA RFEPVHLGSN AFKQASMLLA LFAGGDGYRV EEHEGCLMLG WHSRPLITTS  540
AWKLSG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A1e-6317254213377Protein SCARECROW
5b3h_D1e-6317254213377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017236039.10.0PREDICTED: DELLA protein GAI1
SwissprotQ8S4W70.0GAI1_VITVI; DELLA protein GAI1
TrEMBLA0A166EEX80.0A0A166EEX8_DAUCS; Uncharacterized protein
STRINGPOPTR_0008s13090.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein