PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_007210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family bZIP
Protein Properties Length: 200aa    MW: 22747.3 Da    PI: 6.509
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_007210genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.12.2e-1485132552
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                  ++ rr+++NRe+ArrsR RK++ ++eL   v  L +eN++L ++l++ 
  DCAR_007210  85 RKKRRMISNRESARRSRMRKQKHLDELWSQVVRLRTENHDLLDKLNNV 132
                  6789**************************************999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.7E-1581145IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.62283146IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.14E-1385133No hitNo description
Gene3DG3DSA:1.20.5.1704.7E-1285158No hitNo description
PfamPF001703.0E-1285132IPR004827Basic-leucine zipper domain
CDDcd147023.60E-2086133No hitNo description
PROSITE patternPS00036088103IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MMFPSEFAGI QTLAQDTPSH FENNCGIIQS DMSTLNYFNN LLANYPNLQN SLLPVYDFNS  60
QSSGFSNNST SDEGDEFQLS IINERKKRRM ISNRESARRS RMRKQKHLDE LWSQVVRLRT  120
ENHDLLDKLN NVSGDHDRVV QENARLKKEA SDLRQMLTEL QLASTYSGLR DLEEVPCTTA  180
HLRTGSSNHC VTSSPVCFN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
184105RKKRRMISNRESARRSRMRKQK
297104RRSRMRKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00647PBMTransfer from LOC_Os02g49560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017234174.11e-148PREDICTED: basic leucine zipper 43-like
SwissprotQ9FMC23e-36BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A162AV951e-146A0A162AV95_DAUCS; Uncharacterized protein
STRINGcassava4.1_022183m5e-75(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9472492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.11e-42basic leucine-zipper 42
Publications ? help Back to Top
  1. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]