PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_006905
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 629aa    MW: 70008.5 Da    PI: 4.4933
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_006905genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like81.87.6e-2670123155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k rl Wt+e+H++F++a+eq+ G+++A Pk+i+e+m+v+gLt+e+v+SHLQkYR+
  DCAR_006905  70 KRRLIWTTEMHQKFLDAIEQI-GHDRAFPKKIVEVMNVPGLTRENVASHLQKYRI 123
                  689******************.********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.55767126IPR017930Myb domain
SuperFamilySSF466896.45E-2068127IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-2669128IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-2270123IPR006447Myb domain, plants
PfamPF002491.1E-575122IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 629 aa     Download sequence    Send to blast
MEKEIQELYE KGGDEADADH VTRESSNKTD AFLRDETNQT TKNGKGKDHK ESSSEPDTSG  60
DQDDSHVPKK RRLIWTTEMH QKFLDAIEQI GHDRAFPKKI VEVMNVPGLT RENVASHLQK  120
YRICLKKVQE GMDKYYWGPN TEANCTRVPY AYESLLGTPR HHFSGSSHLA SRNFYSMSSS  180
SHSSLYGQCS AIGNSRVRLA PPSYSSFDVS SLSMNTGNVP TQYNQMTEVN TNVRGYCDDK  240
RNKLLSILNR RPTSNTPDDH ATSSSSTSNS AFIGLRIASD GKSLFLGGSD RSEIVPAENY  300
SAKRNDFNLQ ESALPPLTCS NIENYFQDSS LPPLPGSNTE DHFGDSSFPS FPEFQVENSW  360
QQLKTSENEH ISWQQLARNI EDDLITFNPQ QETYGTNETE NGHTGTYLEQ QNCLHSLPWE  420
ILENADWELI KKILPNNHTV NPLPSLSAPS NPNSNMASCL INNNLSNQED SLPPLPSDIP  480
WSLYPDSNSS NHSANVLNQQ NLLPPLVSET GWNETSDVST MPINNISDHQ NLLASFPSDY  540
FWNLDSDPVH PIIVPPSVPE AYEGAVQQPP SLPDNTVNQV IPQPINTYFS ESNFEEGIGD  600
IKNLEEGIGD SSPGLLDFIG FHDTLSNE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-2069128463ARR10-B
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017231592.10.0PREDICTED: two-component response regulator ARR18-like
RefseqXP_017231593.10.0PREDICTED: two-component response regulator ARR18-like
TrEMBLA0A166E4610.0A0A166E461_DAUCS; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.12e-24response regulator 2