PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_006868
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 184aa    MW: 20126.3 Da    PI: 5.231
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_006868genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26081.21.7e-25239627100
       DUF260  27 pkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                  +++fa+vhk+FGasn +k+l ++p+++r+da+ sl+yeA  r++dPvyG+v++i++lqqq+++l+aela+++++
  DCAR_006868  23 TSHFAAVHKVFGASNASKILLQIPPHKRHDAVVSLCYEAVSRVSDPVYGCVSHIFTLQQQVDELQAELAYIQAR 96 
                  579******************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089113.178197IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-242394IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MSSRNDDNHM VTVRGEGSDH LGTSHFAAVH KVFGASNASK ILLQIPPHKR HDAVVSLCYE  60
AVSRVSDPVY GCVSHIFTLQ QQVDELQAEL AYIQARLSVI RCRPTVQTPS SIDLQSSLEL  120
QASADIKNSQ QLANSQPELT SSNTASNRNP REDINEEEDD DLQRLARELV AKYLPGLNFG  180
SGD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-22269040104LOB family transfactor Ramosa2.1
5ly0_B3e-22269040104LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017234536.11e-117PREDICTED: LOB domain-containing protein 19-like
TrEMBLA0A166E3921e-132A0A166E392_DAUCS; Uncharacterized protein
STRINGEOX961941e-51(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45410.12e-40LOB domain-containing protein 19