PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_006825
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 704aa    MW: 77566.5 Da    PI: 6.5778
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_006825genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS315.11.5e-963457023374
         GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                  ++L++  e + sg+++ aqa+Larl+++ s + +p+qR+a+yf+eAL++ l++  s  ++ ++++  ++ +   ++ a+k++sevsP+++f ++t Nq
  DCAR_006825 345 DQLYKTTELMLSGNFSHAQAILARLNHQLSLNIKPFQRAAFYFKEALQTSLLEI-SDPVSPISSRIPTPVDGMFKIGAYKVLSEVSPLVQFMNFTSNQ 441
                  68999999********************************************95.5555578888888899*************************** PP

         GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                  a+lea+ +++ +HiiDfdi+ G+QW ++lq+L   +++ppsl+iT+++sp+++++ el  ++e+L++fA+++gv+fe +v+   +++++++++ +++ 
  DCAR_006825 442 ALLEALGNADSIHIIDFDIGFGAQWSSFLQELPRTDRSPPSLKITAFASPATHHAIELGLMHENLTQFATKMGVSFELEVV---NFDSFDPNSYATSL 536
                  ********************************************************************************8...9********99987 PP

         GRAS 199 .gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl.eaklpreseerikvErellgrei 294
                   +Ea+aVn+ l   + +    +     +++L+++k+lsPk+++ +++ +++ + ++ +++l+al+yy  lfdsl +a+   +s++ +k+Er+l++++i
  DCAR_006825 537 eNEAVAVNFPLWSASNH--LPA----LPSLLSFIKRLSPKIMISMDRGCERIDLPYPQHLLHALQYYEILFDSLnAAN--VTSDTVSKMERFLFQPKI 626
                  7********99544433..344....456*********************************************5555..599*************** PP

         GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  +++v+ + +      e++  W++ + ++GF+pv++s++a++qa++l ++++++g++ve++++slvl+W++ +L+s+SaWr
  DCAR_006825 627 RSMVSGRLRF----PEQMLPWKSVFASMGFSPVAFSNFAETQAECLAKRTQVRGFHVEKHQASLVLCWQNCELMSLSAWR 702
                  ****988887....999**************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.977317682IPR005202Transcription factor GRAS
PfamPF035145.2E-94345702IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 704 aa     Download sequence    Send to blast
MRGIGYNLQA IVDNKGSSFE AKCKKEAILG GIHESLFPLD TKRSPSPSTS TSALSSSFGG  60
GGGNASSGGG GHNNSANLVL ISEDTMNPKW QVSEPENERE SGGRKDEWAV ELQPISGAGS  120
PQRFGLGNGM EDWESLFSDT ASHDQLRWIS GDVDETPLSL KQLLQGGNNH EIEDASAIQP  180
WGNAATNFNS NMGVSNSGFT SALAPNSRVL NYNPNPQAPN SPLPVNHQFM NQNMGNLDMS  240
SVLLQANSNN GQKDHNHYEP QPKRHNLGIP NCTTGVAKSP FDGFLPSIKQ HQMGFANQCN  300
LLPPHQLLQK PFITPKQELT GGIREKISPA SHLHQHQQQQ QVIYDQLYKT TELMLSGNFS  360
HAQAILARLN HQLSLNIKPF QRAAFYFKEA LQTSLLEISD PVSPISSRIP TPVDGMFKIG  420
AYKVLSEVSP LVQFMNFTSN QALLEALGNA DSIHIIDFDI GFGAQWSSFL QELPRTDRSP  480
PSLKITAFAS PATHHAIELG LMHENLTQFA TKMGVSFELE VVNFDSFDPN SYATSLENEA  540
VAVNFPLWSA SNHLPALPSL LSFIKRLSPK IMISMDRGCE RIDLPYPQHL LHALQYYEIL  600
FDSLNAANVT SDTVSKMERF LFQPKIRSMV SGRLRFPEQM LPWKSVFASM GFSPVAFSNF  660
AETQAECLAK RTQVRGFHVE KHQASLVLCW QNCELMSLSA WRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A5e-3038170157378Protein SCARECROW
5b3h_A4e-3038170156377Protein SCARECROW
5b3h_D4e-3038170156377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017236191.10.0PREDICTED: scarecrow-like protein 27
SwissprotO813161e-110SCL6_ARATH; Scarecrow-like protein 6
TrEMBLA0A166E2480.0A0A166E248_DAUCS; Uncharacterized protein
STRINGLus100289340.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA69861931
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-113GRAS family protein
Publications ? help Back to Top
  1. Bari A,Orazova S,Ivashchenko A
    miR156- and miR171-binding sites in the protein-coding sequences of several plant genes.
    Biomed Res Int, 2013. 2013: p. 307145
    [PMID:23936788]
  2. Xue XY, et al.
    Interaction between two timing microRNAs controls trichome distribution in Arabidopsis.
    PLoS Genet., 2014. 10(4): p. e1004266
    [PMID:24699192]