PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_006824
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 706aa    MW: 77975.8 Da    PI: 6.4027
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_006824genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS319.38.2e-983477043374
         GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                  ++L+++ e + sg+++ aqa+Larl+++ s + +p+qR+a+yf+eAL++ l++ ++ ++  ++++  ++ +   ++ a+k++sevsP+++f ++t Nq
  DCAR_006824 347 DQLYKATELILSGNFSHAQAILARLNHQLSLNIKPFQRAAFYFKEALQTSLLEISDPVS-PITSRIPTPVDGMFKIGAYKVLSEVSPLVQFMNFTSNQ 443
                  689*************************************************9555555.67777777799*************************** PP

         GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                  a+lea+ +++ +HiiDf+i+ G+QW ++lq+L   +++ppsl+iT+++sp+++++ el  ++e+L++fA+++gv+fe +v+   +++++++++ +v+ 
  DCAR_006824 444 ALLEALGNADSIHIIDFNIGFGAQWSSFLQELPRTDRSPPSLKITAFASPATHHHIELGLMHENLTQFATKMGVSFELEVV---NFDSFDPNSYSVSL 538
                  ********************************************************************************8...9***********98 PP

         GRAS 199 .gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreiv 295
                   +Ea+aVn+ l   + +    +     +++L+++k+lsPk++v +++ +++ + ++ +++l++l+yy  lfdsl+a    +s++ +k+Er+l++++i+
  DCAR_006824 539 eNEAVAVNFPLWSASNH--LPA----LPSLLSFIKRLSPKIMVSMDRGCERIDLPYPQHLLHTLQYYEILFDSLDAA-NVTSDTVSKIERFLFQPKIR 629
                  8********99544433..344....456*********************************************666.5799**************** PP

         GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  ++v+ +        e++  W++ + ++GF+pv++s++a++qa++l ++++++g++ve+++ slvl+Wk+r+L+s+SaWr
  DCAR_006824 630 SMVSGRLHF----PEQMLPWKSVFASMGFSPVAFSNFAETQAECLAKRTQVRGFHVEKHQTSLVLCWKNRELMSLSAWR 704
                  ***987776....9****************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.51319684IPR005202Transcription factor GRAS
PfamPF035142.8E-95347704IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 706 aa     Download sequence    Send to blast
MRGIGYNLQA IVDNNKGSSF EASCKKEALL SGIHEPLFAL DTKRSPSPST STSTLSSSFG  60
GGGGNTSSGG GGHNNSANLV LISEDTMNPK WQVSVPENER ESSGRKDEWA TELQPISGAG  120
SPQRFGLGNG MEDWESLFSD SASHDQLRWI SGEVDETPLS LKQLLQGGNN DEIEDSSAIQ  180
PWGNAATNFN SNMGVSNSGF TSALAPNSRA LNYNPNPQNP ISPLPANHLL MNQNMNNLDM  240
SSVLLQANIN NSQKDQHQYE PQPKRHNLGI PNCTTGVAKT PFADEFLPSI KQPQLGFGNQ  300
FNLLPPHQLL QKPFITPKQE LTGGIREQIS AASHLHQHQQ QQQVIYDQLY KATELILSGN  360
FSHAQAILAR LNHQLSLNIK PFQRAAFYFK EALQTSLLEI SDPVSPITSR IPTPVDGMFK  420
IGAYKVLSEV SPLVQFMNFT SNQALLEALG NADSIHIIDF NIGFGAQWSS FLQELPRTDR  480
SPPSLKITAF ASPATHHHIE LGLMHENLTQ FATKMGVSFE LEVVNFDSFD PNSYSVSLEN  540
EAVAVNFPLW SASNHLPALP SLLSFIKRLS PKIMVSMDRG CERIDLPYPQ HLLHTLQYYE  600
ILFDSLDAAN VTSDTVSKIE RFLFQPKIRS MVSGRLHFPE QMLPWKSVFA SMGFSPVAFS  660
NFAETQAECL AKRTQVRGFH VEKHQTSLVL CWKNRELMSL SAWRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3036470422375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017236604.10.0PREDICTED: scarecrow-like protein 15
SwissprotO813161e-110SCL6_ARATH; Scarecrow-like protein 6
TrEMBLA0A166E2420.0A0A166E242_DAUCS; Uncharacterized protein
STRINGLus100289340.0(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA69861931
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-112GRAS family protein
Publications ? help Back to Top
  1. Bari A,Orazova S,Ivashchenko A
    miR156- and miR171-binding sites in the protein-coding sequences of several plant genes.
    Biomed Res Int, 2013. 2013: p. 307145
    [PMID:23936788]
  2. Xue XY, et al.
    Interaction between two timing microRNAs controls trichome distribution in Arabidopsis.
    PLoS Genet., 2014. 10(4): p. e1004266
    [PMID:24699192]