PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_006686
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family bZIP
Protein Properties Length: 380aa    MW: 42633 Da    PI: 8.9951
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_006686genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_122.91.9e-072432891763
                  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  A+rsR RK+++i+eLe+ v++L+a+ ++   ele l+++   l +e+
  DCAR_006686 243 AQRSRVRKLQYIAELERNVQALQAKGSEVSAELEFLNQQNLILSMEN 289
                  89***********************************9998887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.0027232291IPR004827Basic-leucine zipper domain
CDDcd147034.37E-15234282No hitNo description
Gene3DG3DSA:1.20.5.1703.1E-5243286No hitNo description
SuperFamilySSF579591.83E-5243285No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MANSKGPSSY KNVLYNGKHS LLPPKSPFPS ISPSYLDYVQ TSTIGVKGLP KPREGYQHHQ  60
RTSSESTLIE DQPSWLDELL NEPETPVRRG HRRSSSDSFA YMEVANANLN YATQDEYRSR  120
NMSPVPSRTS QDFDYYKDVR CDSFYPDVNP LGKSKSRVWD PPSNSLAHPV GPLSVKDNSA  180
IQNSVSSFST QETDGFASNT TEKQNPIESS PYDAKASSEK KDSSYAKASA SETDTKRSKQ  240
QFAQRSRVRK LQYIAELERN VQALQAKGSE VSAELEFLNQ QNLILSMENK ALKQRLENVS  300
QEQVIKYLEH DVLEREIGRL RALYQQQQQP PQQLPSSGHR RANSRDTNSK DLDSQFANLS  360
LKHKDSSSGR DAVSGPLHI*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017235646.10.0PREDICTED: uncharacterized protein At4g06598-like
SwissprotQ8W3M71e-60Y4598_ARATH; Uncharacterized protein At4g06598
TrEMBLA0A161XFZ80.0A0A161XFZ8_DAUCS; Uncharacterized protein
STRINGEOX981121e-168(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27651733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.24e-92bZIP family protein
Publications ? help Back to Top
  1. Kumekawa N,Hosouchi T,Tsuruoka H,Kotani H
    The size and sequence organization of the centromeric region of Arabidopsis thaliana chromosome 4.
    DNA Res., 2001. 8(6): p. 285-90
    [PMID:11853315]